Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0K3CDM0

Protein Details
Accession A0A0K3CDM0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
18-39KIPYRLTPTRKTRQRLRLKAVDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24.5, cyto_mito 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFRPSQTALGGLLWKIPYRLTPTRKTRQRLRLKAVDDVIAKVQASGVQTHSLTRCLALPTEQEMPARDKYTVFSRYGRNYRKGIHKVPHWTKVTSRVNPKGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.14
4 0.14
5 0.14
6 0.13
7 0.14
8 0.21
9 0.3
10 0.34
11 0.43
12 0.51
13 0.62
14 0.69
15 0.74
16 0.76
17 0.78
18 0.83
19 0.82
20 0.81
21 0.78
22 0.73
23 0.7
24 0.61
25 0.55
26 0.44
27 0.36
28 0.28
29 0.21
30 0.18
31 0.13
32 0.11
33 0.08
34 0.08
35 0.08
36 0.08
37 0.09
38 0.09
39 0.11
40 0.11
41 0.11
42 0.1
43 0.1
44 0.1
45 0.09
46 0.1
47 0.09
48 0.1
49 0.12
50 0.15
51 0.15
52 0.15
53 0.16
54 0.19
55 0.21
56 0.21
57 0.18
58 0.16
59 0.18
60 0.24
61 0.26
62 0.25
63 0.26
64 0.31
65 0.39
66 0.49
67 0.53
68 0.53
69 0.53
70 0.57
71 0.63
72 0.65
73 0.65
74 0.63
75 0.64
76 0.69
77 0.73
78 0.76
79 0.69
80 0.64
81 0.6
82 0.62
83 0.64
84 0.62
85 0.64