Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0K3CBN8

Protein Details
Accession A0A0K3CBN8    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
14-43KAVKKAPASGDDKKRKRKTRKETYSSYIYKHydrophilic
NLS Segment(s)
PositionSequence
12-34AKKAVKKAPASGDDKKRKRKTRK
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR007125  Histone_H2A/H2B/H3  
IPR000558  Histone_H2B  
Gene Ontology GO:0000786  C:nucleosome  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0030527  F:structural constituent of chromatin  
Pfam View protein in Pfam  
PF00125  Histone  
PROSITE View protein in PROSITE  
PS00357  HISTONE_H2B  
Amino Acid Sequences MAPKSTTAEAPAKKAVKKAPASGDDKKRKRKTRKETYSSYIYKVLKQVHPDTGISNKAMLILNSFVNDIFERIATEASKLASYNKKSTISSREIQTSVRLILPGELSKHAISEGTKAVTKFSSTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.47
3 0.48
4 0.5
5 0.52
6 0.52
7 0.55
8 0.59
9 0.63
10 0.68
11 0.69
12 0.74
13 0.78
14 0.81
15 0.84
16 0.88
17 0.9
18 0.9
19 0.91
20 0.93
21 0.9
22 0.87
23 0.83
24 0.81
25 0.72
26 0.64
27 0.59
28 0.49
29 0.43
30 0.4
31 0.39
32 0.33
33 0.36
34 0.36
35 0.32
36 0.33
37 0.31
38 0.28
39 0.26
40 0.24
41 0.19
42 0.17
43 0.13
44 0.13
45 0.12
46 0.11
47 0.09
48 0.08
49 0.08
50 0.08
51 0.08
52 0.06
53 0.07
54 0.07
55 0.07
56 0.06
57 0.05
58 0.06
59 0.06
60 0.07
61 0.06
62 0.07
63 0.07
64 0.08
65 0.08
66 0.08
67 0.12
68 0.18
69 0.22
70 0.25
71 0.29
72 0.31
73 0.32
74 0.37
75 0.39
76 0.38
77 0.39
78 0.38
79 0.38
80 0.36
81 0.36
82 0.34
83 0.29
84 0.25
85 0.21
86 0.18
87 0.14
88 0.15
89 0.16
90 0.15
91 0.15
92 0.16
93 0.17
94 0.17
95 0.17
96 0.16
97 0.16
98 0.14
99 0.16
100 0.17
101 0.18
102 0.21
103 0.21
104 0.23
105 0.22