Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0K3CNB8

Protein Details
Accession A0A0K3CNB8   
Localization Confidence Medium
Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
110-129EADGASSRTKRKKGKKKQGKBasic
NLS Segment(s)
PositionSequence
116-129SRTKRKKGKKKQGK
Subcellular Location(s) nucl 22, cyto_nucl 13.5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009018  Signal_recog_particle_SRP9/14  
IPR039914  SRP9-like  
Gene Ontology GO:0048500  C:signal recognition particle  
GO:0008312  F:7S RNA binding  
GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
Amino Acid Sequences MLYRDFDRFKQACEELYARSGPKTRTCIRWRADVGLLVMRLTDDVQTLTFKTRSKSFLNRFDSLNLTLLRKYHNRGRLSAHAQLDAPGPSEHTIPDPSVSLSAGDGAKGEADGASSRTKRKKGKKKQGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.29
3 0.32
4 0.32
5 0.25
6 0.27
7 0.3
8 0.28
9 0.33
10 0.38
11 0.4
12 0.47
13 0.52
14 0.57
15 0.56
16 0.61
17 0.57
18 0.54
19 0.5
20 0.43
21 0.38
22 0.33
23 0.3
24 0.2
25 0.17
26 0.13
27 0.11
28 0.09
29 0.08
30 0.05
31 0.05
32 0.06
33 0.07
34 0.08
35 0.11
36 0.13
37 0.14
38 0.16
39 0.19
40 0.23
41 0.27
42 0.36
43 0.4
44 0.47
45 0.52
46 0.51
47 0.49
48 0.46
49 0.43
50 0.35
51 0.3
52 0.21
53 0.16
54 0.15
55 0.15
56 0.17
57 0.17
58 0.2
59 0.24
60 0.3
61 0.31
62 0.33
63 0.38
64 0.42
65 0.45
66 0.47
67 0.42
68 0.35
69 0.33
70 0.32
71 0.28
72 0.2
73 0.17
74 0.11
75 0.11
76 0.11
77 0.11
78 0.11
79 0.11
80 0.12
81 0.11
82 0.12
83 0.12
84 0.11
85 0.12
86 0.12
87 0.1
88 0.08
89 0.1
90 0.09
91 0.09
92 0.08
93 0.08
94 0.07
95 0.07
96 0.07
97 0.04
98 0.06
99 0.07
100 0.09
101 0.16
102 0.19
103 0.27
104 0.35
105 0.44
106 0.53
107 0.64
108 0.73
109 0.78