Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A061B474

Protein Details
Accession A0A061B474    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
58-88MELIRNSKDKKARKLTKKRLGTLRRAKRKVDBasic
NLS Segment(s)
PositionSequence
63-86NSKDKKARKLTKKRLGTLRRAKRK
Subcellular Location(s) mito 18, cyto 5, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR038097  L36e_sf  
IPR000509  Ribosomal_L36e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01158  Ribosomal_L36e  
PROSITE View protein in PROSITE  
PS01190  RIBOSOMAL_L36E  
Amino Acid Sequences MAARSNLPWGLNRGHPTTVIAKVPKPSNRKGKQSARSAFVKSVVREVAGFAPYERRVMELIRNSKDKKARKLTKKRLGTLRRAKRKVDELTGVIAEQRRHAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.3
3 0.31
4 0.31
5 0.31
6 0.3
7 0.28
8 0.27
9 0.32
10 0.39
11 0.43
12 0.45
13 0.5
14 0.56
15 0.61
16 0.68
17 0.72
18 0.75
19 0.76
20 0.79
21 0.75
22 0.69
23 0.65
24 0.59
25 0.5
26 0.45
27 0.4
28 0.3
29 0.29
30 0.24
31 0.2
32 0.18
33 0.18
34 0.14
35 0.11
36 0.11
37 0.08
38 0.11
39 0.11
40 0.12
41 0.11
42 0.1
43 0.1
44 0.11
45 0.16
46 0.2
47 0.26
48 0.29
49 0.35
50 0.36
51 0.41
52 0.48
53 0.51
54 0.54
55 0.59
56 0.65
57 0.71
58 0.8
59 0.86
60 0.88
61 0.89
62 0.87
63 0.86
64 0.84
65 0.84
66 0.84
67 0.83
68 0.84
69 0.81
70 0.77
71 0.74
72 0.75
73 0.71
74 0.67
75 0.61
76 0.52
77 0.51
78 0.47
79 0.4
80 0.34
81 0.31
82 0.24