Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0K3CM55

Protein Details
Accession A0A0K3CM55   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
89-115AIAAKVSKTKRKAYKPKFKSWAKNLLSHydrophilic
NLS Segment(s)
PositionSequence
95-107SKTKRKAYKPKFK
Subcellular Location(s) mito 16, nucl 6, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR017336  Snurportin-1  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:0003723  F:RNA binding  
GO:0061015  P:snRNA import into nucleus  
Amino Acid Sequences MPTMADPSHRRASYLAAPLTAHSSQEKRRQLALEAQKQRRTHAIEAARASFRELDPMEDLSLDASSASEEEYAPAPPTAHSPPPPTSEAIAAKVSKTKRKAYKPKFKSWAKNLLSYAETLDLRYSLPAGLENEWRAVVVLKGKRCLCATASDQAGNNTILYSRVAGRALGRFNTQLPPDCLLDAIWDPDLAILWILDLCKWRSTYFVECEAEMRAFFLSSKLTELPTQPYVPPTVEIPPGTTNARPLLVLPAPSNAPPLTPPVLSPLLSALSGPSPPAQSIPVEVFFPSDPSDTTQLFPTQLDIPLHPTGLLLYLSHAHYESGSTPLVSWVPCSPNVERGMERGEGVERMRELVEEWAARGGPAAVVTSDGGAGGSQEVAMSPFVG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.41
3 0.33
4 0.33
5 0.33
6 0.37
7 0.32
8 0.26
9 0.22
10 0.27
11 0.34
12 0.43
13 0.5
14 0.48
15 0.53
16 0.54
17 0.54
18 0.57
19 0.6
20 0.61
21 0.63
22 0.68
23 0.69
24 0.67
25 0.66
26 0.64
27 0.6
28 0.53
29 0.52
30 0.51
31 0.5
32 0.53
33 0.55
34 0.49
35 0.43
36 0.41
37 0.35
38 0.28
39 0.28
40 0.24
41 0.23
42 0.23
43 0.24
44 0.22
45 0.19
46 0.19
47 0.13
48 0.12
49 0.09
50 0.06
51 0.05
52 0.05
53 0.05
54 0.05
55 0.05
56 0.05
57 0.07
58 0.08
59 0.09
60 0.1
61 0.11
62 0.11
63 0.1
64 0.15
65 0.18
66 0.23
67 0.25
68 0.29
69 0.32
70 0.36
71 0.38
72 0.36
73 0.32
74 0.32
75 0.3
76 0.28
77 0.28
78 0.24
79 0.23
80 0.27
81 0.31
82 0.33
83 0.37
84 0.43
85 0.49
86 0.6
87 0.71
88 0.76
89 0.82
90 0.83
91 0.88
92 0.89
93 0.88
94 0.87
95 0.84
96 0.84
97 0.76
98 0.74
99 0.64
100 0.57
101 0.48
102 0.39
103 0.31
104 0.24
105 0.2
106 0.14
107 0.14
108 0.11
109 0.1
110 0.1
111 0.09
112 0.06
113 0.06
114 0.08
115 0.1
116 0.11
117 0.13
118 0.14
119 0.14
120 0.14
121 0.13
122 0.12
123 0.1
124 0.09
125 0.14
126 0.18
127 0.19
128 0.25
129 0.26
130 0.28
131 0.28
132 0.29
133 0.23
134 0.24
135 0.25
136 0.23
137 0.24
138 0.24
139 0.23
140 0.22
141 0.23
142 0.18
143 0.15
144 0.1
145 0.09
146 0.08
147 0.08
148 0.08
149 0.07
150 0.08
151 0.09
152 0.09
153 0.1
154 0.13
155 0.15
156 0.15
157 0.15
158 0.14
159 0.16
160 0.18
161 0.18
162 0.18
163 0.18
164 0.2
165 0.19
166 0.18
167 0.16
168 0.13
169 0.13
170 0.1
171 0.09
172 0.07
173 0.06
174 0.06
175 0.06
176 0.06
177 0.04
178 0.04
179 0.03
180 0.02
181 0.03
182 0.03
183 0.04
184 0.06
185 0.07
186 0.09
187 0.1
188 0.1
189 0.12
190 0.16
191 0.19
192 0.2
193 0.25
194 0.24
195 0.23
196 0.24
197 0.23
198 0.2
199 0.15
200 0.13
201 0.07
202 0.06
203 0.06
204 0.06
205 0.06
206 0.06
207 0.09
208 0.09
209 0.1
210 0.11
211 0.13
212 0.16
213 0.17
214 0.18
215 0.17
216 0.17
217 0.18
218 0.17
219 0.16
220 0.13
221 0.14
222 0.14
223 0.14
224 0.15
225 0.15
226 0.16
227 0.17
228 0.16
229 0.16
230 0.15
231 0.15
232 0.13
233 0.12
234 0.15
235 0.14
236 0.15
237 0.14
238 0.14
239 0.15
240 0.15
241 0.17
242 0.12
243 0.11
244 0.11
245 0.14
246 0.15
247 0.14
248 0.14
249 0.16
250 0.18
251 0.18
252 0.17
253 0.15
254 0.13
255 0.13
256 0.13
257 0.09
258 0.08
259 0.08
260 0.09
261 0.09
262 0.09
263 0.09
264 0.1
265 0.11
266 0.1
267 0.12
268 0.14
269 0.13
270 0.13
271 0.13
272 0.14
273 0.12
274 0.13
275 0.13
276 0.11
277 0.11
278 0.14
279 0.18
280 0.17
281 0.18
282 0.19
283 0.19
284 0.19
285 0.18
286 0.18
287 0.16
288 0.19
289 0.19
290 0.17
291 0.21
292 0.21
293 0.21
294 0.19
295 0.17
296 0.13
297 0.13
298 0.13
299 0.07
300 0.08
301 0.11
302 0.11
303 0.12
304 0.12
305 0.11
306 0.11
307 0.12
308 0.12
309 0.12
310 0.12
311 0.11
312 0.11
313 0.13
314 0.15
315 0.13
316 0.14
317 0.16
318 0.18
319 0.21
320 0.25
321 0.25
322 0.3
323 0.34
324 0.36
325 0.32
326 0.32
327 0.33
328 0.3
329 0.28
330 0.23
331 0.21
332 0.2
333 0.2
334 0.21
335 0.18
336 0.18
337 0.18
338 0.17
339 0.16
340 0.17
341 0.2
342 0.17
343 0.17
344 0.18
345 0.18
346 0.17
347 0.17
348 0.13
349 0.1
350 0.09
351 0.1
352 0.07
353 0.09
354 0.09
355 0.09
356 0.08
357 0.07
358 0.07
359 0.06
360 0.06
361 0.05
362 0.05
363 0.05
364 0.05
365 0.05
366 0.06