Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0K3CHC4

Protein Details
Accession A0A0K3CHC4   
Localization Confidence Low
Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
135-159DIPAGNEGVRRRRRRRDGEAQEAVPHydrophilic
NLS Segment(s)
PositionSequence
144-150RRRRRRR
Subcellular Location(s) mito 20, cyto 3, nucl 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR045298  Complex1_LYR_LYRM7  
Gene Ontology GO:0005759  C:mitochondrial matrix  
GO:0034551  P:mitochondrial respiratory chain complex III assembly  
CDD cd20267  Complex1_LYR_LYRM7  
Amino Acid Sequences MSLTLTPAQCARAASAYRALLRSQRLTFKGDELALKAAHQQTRILFNRFIPSSSASRSPFASQNPLVPPPQLAPKDELTPEKVDEHIDGAFEIAKFLRTNVVQGVRTDEGNYALRIHEETERGDNDTVKQPKPLDIPAGNEGVRRRRRRRDGEAQEAVPVGCCGGAGAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.27
3 0.29
4 0.3
5 0.3
6 0.3
7 0.29
8 0.32
9 0.36
10 0.34
11 0.38
12 0.38
13 0.4
14 0.4
15 0.37
16 0.36
17 0.31
18 0.29
19 0.23
20 0.24
21 0.2
22 0.19
23 0.21
24 0.22
25 0.23
26 0.22
27 0.22
28 0.22
29 0.31
30 0.35
31 0.34
32 0.31
33 0.31
34 0.36
35 0.34
36 0.33
37 0.26
38 0.25
39 0.24
40 0.25
41 0.29
42 0.24
43 0.25
44 0.26
45 0.26
46 0.26
47 0.26
48 0.29
49 0.24
50 0.26
51 0.28
52 0.28
53 0.26
54 0.23
55 0.21
56 0.17
57 0.23
58 0.2
59 0.19
60 0.19
61 0.2
62 0.22
63 0.23
64 0.23
65 0.19
66 0.19
67 0.19
68 0.17
69 0.16
70 0.14
71 0.12
72 0.12
73 0.09
74 0.08
75 0.07
76 0.06
77 0.06
78 0.06
79 0.06
80 0.05
81 0.06
82 0.06
83 0.06
84 0.09
85 0.08
86 0.1
87 0.13
88 0.17
89 0.16
90 0.17
91 0.21
92 0.19
93 0.19
94 0.19
95 0.16
96 0.15
97 0.16
98 0.16
99 0.12
100 0.11
101 0.11
102 0.11
103 0.12
104 0.12
105 0.12
106 0.14
107 0.17
108 0.18
109 0.2
110 0.2
111 0.2
112 0.2
113 0.28
114 0.31
115 0.28
116 0.32
117 0.3
118 0.34
119 0.36
120 0.36
121 0.34
122 0.31
123 0.34
124 0.33
125 0.35
126 0.31
127 0.31
128 0.33
129 0.36
130 0.43
131 0.49
132 0.56
133 0.63
134 0.74
135 0.81
136 0.86
137 0.87
138 0.88
139 0.88
140 0.86
141 0.75
142 0.67
143 0.58
144 0.48
145 0.37
146 0.27
147 0.16
148 0.09
149 0.08