Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0K3CFT8

Protein Details
Accession A0A0K3CFT8    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
79-106ETEDKQPKSKRAAKKAKEKKTKKLAELEBasic
NLS Segment(s)
PositionSequence
83-101KQPKSKRAAKKAKEKKTKK
Subcellular Location(s) nucl 18, cyto_nucl 14.5, cyto 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR032704  Cms1  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0004386  F:helicase activity  
Pfam View protein in Pfam  
PF14617  CMS1  
Amino Acid Sequences MAPPSKKTKTDHVPTGDDLEDNFLIEDEFAGASDGEEAERLADLSDDAGAVAAEGGEADDLGPAVSAGKKRSAADAGVETEDKQPKSKRAAKKAKEKKTKKLAELEVDGKDKEDMGFLPVEALADRLAEKQKRALPNLTALEMDEMRISQSMVLDTSSVTARDSLRAFMKEALPTACNTLAKMPKAAGSPRIIVLAGAALRVADLVRDVKEFKAKTKDGLIDVAKLFAKHFKLAEHAEYLKKTHVGLAVGTPNRIEKLLNETESLHLTHLSHLILDVSHLDSKKRSLVDLPEARADLFKLLGSKPIMDRLREGKMKIVVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.62
3 0.52
4 0.42
5 0.34
6 0.29
7 0.23
8 0.18
9 0.16
10 0.12
11 0.11
12 0.1
13 0.1
14 0.06
15 0.06
16 0.06
17 0.06
18 0.06
19 0.06
20 0.07
21 0.07
22 0.06
23 0.06
24 0.06
25 0.06
26 0.06
27 0.06
28 0.05
29 0.05
30 0.05
31 0.06
32 0.06
33 0.05
34 0.05
35 0.05
36 0.04
37 0.04
38 0.04
39 0.03
40 0.03
41 0.03
42 0.03
43 0.03
44 0.03
45 0.03
46 0.03
47 0.03
48 0.03
49 0.03
50 0.03
51 0.04
52 0.07
53 0.1
54 0.12
55 0.16
56 0.19
57 0.2
58 0.24
59 0.25
60 0.23
61 0.24
62 0.24
63 0.23
64 0.22
65 0.21
66 0.19
67 0.23
68 0.27
69 0.25
70 0.28
71 0.3
72 0.34
73 0.44
74 0.51
75 0.55
76 0.61
77 0.72
78 0.75
79 0.82
80 0.86
81 0.88
82 0.9
83 0.88
84 0.87
85 0.87
86 0.86
87 0.8
88 0.79
89 0.73
90 0.67
91 0.64
92 0.58
93 0.5
94 0.44
95 0.38
96 0.29
97 0.24
98 0.19
99 0.14
100 0.11
101 0.08
102 0.08
103 0.08
104 0.07
105 0.07
106 0.07
107 0.07
108 0.06
109 0.06
110 0.04
111 0.04
112 0.05
113 0.07
114 0.13
115 0.14
116 0.15
117 0.2
118 0.26
119 0.3
120 0.33
121 0.34
122 0.3
123 0.35
124 0.35
125 0.31
126 0.25
127 0.21
128 0.19
129 0.15
130 0.14
131 0.08
132 0.06
133 0.06
134 0.06
135 0.06
136 0.04
137 0.05
138 0.05
139 0.05
140 0.05
141 0.05
142 0.05
143 0.06
144 0.06
145 0.05
146 0.05
147 0.07
148 0.07
149 0.1
150 0.1
151 0.11
152 0.13
153 0.14
154 0.15
155 0.15
156 0.17
157 0.15
158 0.15
159 0.15
160 0.13
161 0.13
162 0.14
163 0.13
164 0.11
165 0.11
166 0.15
167 0.18
168 0.18
169 0.18
170 0.17
171 0.17
172 0.2
173 0.21
174 0.2
175 0.18
176 0.19
177 0.18
178 0.19
179 0.16
180 0.13
181 0.12
182 0.09
183 0.07
184 0.06
185 0.05
186 0.04
187 0.04
188 0.04
189 0.04
190 0.03
191 0.04
192 0.05
193 0.06
194 0.08
195 0.09
196 0.11
197 0.17
198 0.18
199 0.23
200 0.3
201 0.3
202 0.31
203 0.36
204 0.37
205 0.32
206 0.37
207 0.33
208 0.27
209 0.27
210 0.27
211 0.22
212 0.19
213 0.18
214 0.18
215 0.19
216 0.17
217 0.18
218 0.17
219 0.21
220 0.24
221 0.25
222 0.25
223 0.26
224 0.27
225 0.28
226 0.28
227 0.26
228 0.24
229 0.22
230 0.2
231 0.2
232 0.17
233 0.16
234 0.19
235 0.24
236 0.24
237 0.24
238 0.22
239 0.2
240 0.2
241 0.2
242 0.16
243 0.1
244 0.18
245 0.23
246 0.24
247 0.24
248 0.25
249 0.26
250 0.27
251 0.26
252 0.19
253 0.15
254 0.14
255 0.14
256 0.15
257 0.13
258 0.11
259 0.11
260 0.11
261 0.09
262 0.09
263 0.09
264 0.1
265 0.14
266 0.15
267 0.17
268 0.18
269 0.21
270 0.26
271 0.26
272 0.25
273 0.26
274 0.32
275 0.41
276 0.46
277 0.46
278 0.44
279 0.44
280 0.42
281 0.38
282 0.32
283 0.22
284 0.16
285 0.15
286 0.14
287 0.14
288 0.19
289 0.2
290 0.22
291 0.23
292 0.32
293 0.35
294 0.33
295 0.39
296 0.39
297 0.47
298 0.48
299 0.47
300 0.45