Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0K3CVF9

Protein Details
Accession A0A0K3CVF9   
Localization Confidence Low
Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
235-254ALVRLGRRRPSRQVNNHLAPHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 16, cyto_nucl 14, nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR003953  FAD-binding_2  
IPR036188  FAD/NAD-bd_sf  
IPR027477  Succ_DH/fumarate_Rdtase_cat_sf  
Gene Ontology GO:0016705  F:oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen  
Pfam View protein in Pfam  
PF00890  FAD_binding_2  
Amino Acid Sequences MTITYALMEKLEDLAESDPTRVKILKKANVRKLVKDGDKVVGCEYEYQGKQHTAHGPVILATVPPELLKLSTTNGDHCQGDGQKMAMAIGANGIDLEKVQVHPTVSLTPGEPDAKVKFLAAEALRGVGGLLINKEGDRFADELGHRRLWLQGDRVALQHYVGRGLMKKFDTVADIAKEMGIEASKLQKTFNEYMDDLRRLPAVSTAPTVSVLVPPRLRRLRRVAGTLPLVPPQVALVRLGRRRPSRQVNNHLAPPSTTITIDPSTQQVHLTLNWSGQGQAQGSAGDVKPQGESTSRSRERGLDCCQAGRGDQGRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.14
3 0.15
4 0.16
5 0.18
6 0.19
7 0.22
8 0.24
9 0.26
10 0.3
11 0.39
12 0.45
13 0.53
14 0.62
15 0.69
16 0.76
17 0.78
18 0.75
19 0.73
20 0.75
21 0.7
22 0.65
23 0.59
24 0.56
25 0.54
26 0.5
27 0.43
28 0.35
29 0.29
30 0.26
31 0.25
32 0.25
33 0.24
34 0.24
35 0.26
36 0.29
37 0.29
38 0.32
39 0.36
40 0.31
41 0.32
42 0.31
43 0.28
44 0.24
45 0.24
46 0.18
47 0.12
48 0.1
49 0.08
50 0.07
51 0.07
52 0.07
53 0.07
54 0.07
55 0.08
56 0.08
57 0.1
58 0.14
59 0.15
60 0.18
61 0.2
62 0.23
63 0.22
64 0.21
65 0.24
66 0.21
67 0.22
68 0.19
69 0.17
70 0.15
71 0.15
72 0.15
73 0.11
74 0.09
75 0.07
76 0.07
77 0.06
78 0.05
79 0.05
80 0.05
81 0.04
82 0.04
83 0.05
84 0.05
85 0.06
86 0.07
87 0.09
88 0.09
89 0.1
90 0.12
91 0.12
92 0.12
93 0.12
94 0.11
95 0.11
96 0.13
97 0.13
98 0.12
99 0.13
100 0.13
101 0.14
102 0.14
103 0.13
104 0.11
105 0.1
106 0.14
107 0.11
108 0.12
109 0.1
110 0.1
111 0.1
112 0.1
113 0.09
114 0.05
115 0.05
116 0.05
117 0.05
118 0.05
119 0.05
120 0.05
121 0.06
122 0.05
123 0.06
124 0.07
125 0.07
126 0.07
127 0.11
128 0.12
129 0.17
130 0.2
131 0.2
132 0.18
133 0.18
134 0.2
135 0.18
136 0.2
137 0.17
138 0.17
139 0.18
140 0.19
141 0.19
142 0.18
143 0.15
144 0.13
145 0.12
146 0.09
147 0.08
148 0.08
149 0.08
150 0.1
151 0.1
152 0.13
153 0.13
154 0.13
155 0.13
156 0.13
157 0.13
158 0.12
159 0.13
160 0.11
161 0.1
162 0.1
163 0.09
164 0.09
165 0.07
166 0.07
167 0.05
168 0.04
169 0.04
170 0.1
171 0.11
172 0.12
173 0.12
174 0.13
175 0.19
176 0.22
177 0.23
178 0.22
179 0.22
180 0.26
181 0.31
182 0.31
183 0.25
184 0.23
185 0.21
186 0.17
187 0.17
188 0.16
189 0.13
190 0.12
191 0.13
192 0.13
193 0.13
194 0.13
195 0.13
196 0.11
197 0.13
198 0.13
199 0.16
200 0.19
201 0.21
202 0.29
203 0.37
204 0.39
205 0.42
206 0.48
207 0.53
208 0.54
209 0.59
210 0.53
211 0.5
212 0.52
213 0.47
214 0.4
215 0.33
216 0.29
217 0.23
218 0.2
219 0.15
220 0.13
221 0.11
222 0.11
223 0.14
224 0.21
225 0.26
226 0.31
227 0.38
228 0.44
229 0.5
230 0.58
231 0.65
232 0.68
233 0.74
234 0.78
235 0.8
236 0.78
237 0.78
238 0.7
239 0.6
240 0.5
241 0.43
242 0.36
243 0.27
244 0.22
245 0.17
246 0.18
247 0.19
248 0.19
249 0.17
250 0.17
251 0.18
252 0.18
253 0.18
254 0.15
255 0.16
256 0.16
257 0.19
258 0.17
259 0.16
260 0.16
261 0.16
262 0.15
263 0.15
264 0.17
265 0.15
266 0.15
267 0.14
268 0.13
269 0.14
270 0.17
271 0.15
272 0.16
273 0.16
274 0.16
275 0.16
276 0.17
277 0.18
278 0.17
279 0.22
280 0.25
281 0.35
282 0.39
283 0.4
284 0.42
285 0.47
286 0.49
287 0.52
288 0.52
289 0.5
290 0.48
291 0.48
292 0.48
293 0.42
294 0.38
295 0.38
296 0.38