Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8ZXR1

Protein Details
Accession G8ZXR1    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
5-28NQRELARQKNLKKQQENSKNGKKAHydrophilic
NLS Segment(s)
PositionSequence
15-35LKKQQENSKNGKKAGDPKKRM
Subcellular Location(s) nucl 22, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007513  SERF-like_N  
KEGG tdl:TDEL_0G03110  -  
Pfam View protein in Pfam  
PF04419  4F5  
Amino Acid Sequences MARGNQRELARQKNLKKQQENSKNGKKAGDPKKRMESDAEILRKKQQAADERKALEQQKVDKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.77
3 0.79
4 0.79
5 0.8
6 0.82
7 0.83
8 0.82
9 0.82
10 0.77
11 0.7
12 0.64
13 0.57
14 0.56
15 0.59
16 0.59
17 0.55
18 0.55
19 0.62
20 0.61
21 0.59
22 0.52
23 0.46
24 0.41
25 0.43
26 0.44
27 0.37
28 0.37
29 0.41
30 0.4
31 0.36
32 0.34
33 0.33
34 0.37
35 0.45
36 0.51
37 0.53
38 0.52
39 0.54
40 0.57
41 0.53
42 0.48
43 0.45