Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8ZRN4

Protein Details
Accession G8ZRN4   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
169-188GTGKVNAKKRKVKSNGSSMAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013942  Mediator_Med19_fun  
Gene Ontology GO:0016592  C:mediator complex  
GO:0003712  F:transcription coregulator activity  
GO:0006357  P:regulation of transcription by RNA polymerase II  
KEGG tdl:TDEL_0C02870  -  
Pfam View protein in Pfam  
PF08633  Rox3  
Amino Acid Sequences MSAAIDEQTLPSYYYYVDPEVTYQASRPNPLEDLISAYGLQDLSHQVARANSDGSKAIKLRKSYKNQISELSGKFGTIPTRENGKGGEVAHILFQNNPDMMNQVRKESGMTPEEYHTAMINRDASLFEPPNLDWNMCRSVLSQFERSYPTEFQNQPGFQVEDLAFDLDGTGKVNAKKRKVKSNGSSMATPNSDMQEDVKRRRLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.15
3 0.15
4 0.16
5 0.15
6 0.16
7 0.18
8 0.19
9 0.17
10 0.16
11 0.21
12 0.22
13 0.26
14 0.26
15 0.26
16 0.26
17 0.26
18 0.27
19 0.2
20 0.23
21 0.2
22 0.19
23 0.15
24 0.14
25 0.14
26 0.13
27 0.12
28 0.08
29 0.09
30 0.1
31 0.12
32 0.12
33 0.12
34 0.13
35 0.15
36 0.15
37 0.16
38 0.13
39 0.14
40 0.17
41 0.17
42 0.2
43 0.2
44 0.25
45 0.28
46 0.34
47 0.41
48 0.47
49 0.55
50 0.61
51 0.67
52 0.68
53 0.65
54 0.63
55 0.59
56 0.55
57 0.47
58 0.41
59 0.32
60 0.24
61 0.23
62 0.21
63 0.19
64 0.14
65 0.15
66 0.13
67 0.19
68 0.19
69 0.19
70 0.19
71 0.17
72 0.18
73 0.17
74 0.17
75 0.12
76 0.12
77 0.12
78 0.12
79 0.11
80 0.09
81 0.09
82 0.09
83 0.08
84 0.08
85 0.07
86 0.08
87 0.09
88 0.14
89 0.14
90 0.14
91 0.14
92 0.14
93 0.15
94 0.15
95 0.18
96 0.14
97 0.15
98 0.15
99 0.16
100 0.17
101 0.16
102 0.15
103 0.12
104 0.11
105 0.1
106 0.1
107 0.1
108 0.09
109 0.09
110 0.09
111 0.09
112 0.13
113 0.13
114 0.12
115 0.13
116 0.13
117 0.17
118 0.18
119 0.17
120 0.13
121 0.15
122 0.18
123 0.16
124 0.17
125 0.13
126 0.15
127 0.22
128 0.25
129 0.26
130 0.24
131 0.27
132 0.3
133 0.3
134 0.32
135 0.27
136 0.27
137 0.31
138 0.31
139 0.33
140 0.37
141 0.35
142 0.33
143 0.34
144 0.32
145 0.24
146 0.27
147 0.22
148 0.16
149 0.17
150 0.16
151 0.12
152 0.1
153 0.11
154 0.08
155 0.08
156 0.08
157 0.08
158 0.11
159 0.16
160 0.24
161 0.32
162 0.41
163 0.5
164 0.55
165 0.65
166 0.71
167 0.77
168 0.77
169 0.81
170 0.8
171 0.75
172 0.72
173 0.63
174 0.6
175 0.51
176 0.44
177 0.35
178 0.29
179 0.25
180 0.22
181 0.23
182 0.27
183 0.34
184 0.39