Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0K3CLY3

Protein Details
Accession A0A0K3CLY3    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
132-154GAPANPKTRERRRRSSSRNAAPAHydrophilic
NLS Segment(s)
PositionSequence
139-146TRERRRRS
Subcellular Location(s) extr 11, mito 6, cyto 5, nucl 3, cyto_pero 3
Family & Domain DBs
Amino Acid Sequences MPVESPLLPLLDLITPYLPNSLANPLYTLASLDIQSVYHNPSQLIPLALSALAAYTAFLSFLSTARFAVRTAISLVKWGSIAAVLGAVWMGVNNAGSEKGVSGGVRDAASYAGQFGRGIFSLGQKGAGYYFGAPANPKTRERRRRSSSRNAAPAGSGGWGDNRDAAAEDFVGNAMKSVLEFVNPPAGSAQEKVKRSAKKAMGGSGSSSSDGGGLGGLAWNLAMGRAKKAWEEMTQEAGGNEPAGRARRNSALVAAPSPSPT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.12
4 0.13
5 0.12
6 0.11
7 0.13
8 0.17
9 0.17
10 0.17
11 0.18
12 0.17
13 0.18
14 0.17
15 0.16
16 0.11
17 0.12
18 0.11
19 0.11
20 0.1
21 0.1
22 0.11
23 0.12
24 0.15
25 0.15
26 0.16
27 0.15
28 0.16
29 0.18
30 0.18
31 0.17
32 0.14
33 0.12
34 0.12
35 0.11
36 0.1
37 0.07
38 0.06
39 0.05
40 0.04
41 0.04
42 0.04
43 0.04
44 0.04
45 0.04
46 0.05
47 0.06
48 0.07
49 0.08
50 0.08
51 0.09
52 0.1
53 0.11
54 0.1
55 0.13
56 0.13
57 0.12
58 0.14
59 0.16
60 0.15
61 0.16
62 0.16
63 0.14
64 0.13
65 0.12
66 0.09
67 0.07
68 0.07
69 0.04
70 0.04
71 0.03
72 0.03
73 0.03
74 0.03
75 0.02
76 0.02
77 0.02
78 0.03
79 0.03
80 0.03
81 0.04
82 0.04
83 0.04
84 0.04
85 0.04
86 0.05
87 0.06
88 0.05
89 0.06
90 0.06
91 0.07
92 0.07
93 0.07
94 0.07
95 0.07
96 0.07
97 0.06
98 0.07
99 0.05
100 0.06
101 0.06
102 0.05
103 0.06
104 0.06
105 0.07
106 0.06
107 0.08
108 0.09
109 0.09
110 0.09
111 0.08
112 0.08
113 0.07
114 0.07
115 0.07
116 0.05
117 0.07
118 0.06
119 0.07
120 0.07
121 0.1
122 0.15
123 0.17
124 0.21
125 0.29
126 0.39
127 0.5
128 0.57
129 0.65
130 0.69
131 0.76
132 0.81
133 0.83
134 0.83
135 0.8
136 0.79
137 0.69
138 0.61
139 0.51
140 0.42
141 0.32
142 0.22
143 0.14
144 0.07
145 0.07
146 0.07
147 0.07
148 0.08
149 0.07
150 0.07
151 0.07
152 0.07
153 0.07
154 0.06
155 0.06
156 0.05
157 0.06
158 0.06
159 0.05
160 0.05
161 0.04
162 0.04
163 0.04
164 0.06
165 0.06
166 0.06
167 0.07
168 0.08
169 0.15
170 0.15
171 0.15
172 0.14
173 0.15
174 0.16
175 0.17
176 0.24
177 0.23
178 0.25
179 0.3
180 0.37
181 0.42
182 0.45
183 0.53
184 0.5
185 0.51
186 0.52
187 0.53
188 0.49
189 0.44
190 0.42
191 0.36
192 0.31
193 0.24
194 0.21
195 0.15
196 0.12
197 0.11
198 0.08
199 0.05
200 0.04
201 0.04
202 0.04
203 0.04
204 0.04
205 0.03
206 0.03
207 0.03
208 0.05
209 0.09
210 0.09
211 0.13
212 0.15
213 0.17
214 0.18
215 0.23
216 0.26
217 0.26
218 0.31
219 0.31
220 0.34
221 0.33
222 0.32
223 0.29
224 0.26
225 0.22
226 0.16
227 0.13
228 0.09
229 0.13
230 0.16
231 0.19
232 0.2
233 0.24
234 0.29
235 0.32
236 0.33
237 0.33
238 0.34
239 0.35
240 0.34
241 0.31