FuNGI

A0A238FEB0

Protein Details

Accession

A0A238FEB0

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
66-91	RPSSGPKPPVPRKSSARRDAQNRLSF	Hydrophilic

NLS Segment(s)

Position	Sequence
70-79	GPKPPVPRKS

Subcellular Location(s)

mito 24.5, cyto_mito 13

Family & Domain DBs

Amino Acid Sequences

MSLRASSESQKNLLKPATTSGTRAESGATPATSSGPSHPQRQVTPGRTRVPSSDTATLLGLKGSHRPSSGPKPPVPRKSSARRDAQNRLSFKTTVGSLLPNPGSRHESVQLGGPAAHFCTTARNSSFNVGKPAQVVFAVLTGITPSTQPSTTATAKATASETTSLLARTASSFGKVRALSSPWSEKAVETGHRGLLAPSAPLEPVMSKQTVQGNAAVAAVSAKSIAKLKKQLLDPQQARKVVQDLKRMELPPNLAAAGIEGTGGSESDQLPPGAHLPSTKGYALAPLVIPAADGPASTTDGIAAAAAPSDTTNPATSDSLIPSPGSPSAPYFVIPTPGAVASDLTKIAGPGAIEAAKEGAYELLADISGAMVRRSGAQNGMKAPFDGMGVFIYYWGFEITVPPATMATLSKVRNFQNTVFAVLQAFVIAGGAPELTPFIRYISTYMDIEWDGMQRQDKGELLPQRRGVGDKC

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.42
2	0.36
3	0.39
4	0.41
5	0.37
6	0.37
7	0.35
8	0.35
9	0.34
10	0.32
11	0.29
12	0.23
13	0.24
14	0.26
15	0.21
16	0.17
17	0.17
18	0.19
19	0.18
20	0.18
21	0.18
22	0.24
23	0.28
24	0.35
25	0.4
26	0.43
27	0.44
28	0.51
29	0.57
30	0.56
31	0.62
32	0.63
33	0.64
34	0.62
35	0.63
36	0.58
37	0.54
38	0.52
39	0.48
40	0.45
41	0.38
42	0.36
43	0.34
44	0.31
45	0.26
46	0.2
47	0.16
48	0.12
49	0.18
50	0.2
51	0.22
52	0.22
53	0.25
54	0.32
55	0.41
56	0.49
57	0.5
58	0.53
59	0.61
60	0.7
61	0.77
62	0.75
63	0.73
64	0.73
65	0.76
66	0.81
67	0.79
68	0.78
69	0.77
70	0.79
71	0.81
72	0.82
73	0.79
74	0.72
75	0.68
76	0.62
77	0.54
78	0.47
79	0.4
80	0.3
81	0.24
82	0.22
83	0.2
84	0.16
85	0.22
86	0.23
87	0.24
88	0.24
89	0.25
90	0.29
91	0.27
92	0.3
93	0.26
94	0.26
95	0.23
96	0.26
97	0.24
98	0.2
99	0.19
100	0.16
101	0.14
102	0.14
103	0.14
104	0.09
105	0.08
106	0.15
107	0.16
108	0.21
109	0.22
110	0.24
111	0.25
112	0.3
113	0.34
114	0.29
115	0.34
116	0.29
117	0.28
118	0.27
119	0.26
120	0.21
121	0.17
122	0.16
123	0.09
124	0.09
125	0.08
126	0.06
127	0.05
128	0.05
129	0.05
130	0.05
131	0.05
132	0.05
133	0.08
134	0.08
135	0.09
136	0.11
137	0.17
138	0.18
139	0.2
140	0.2
141	0.2
142	0.2
143	0.21
144	0.19
145	0.14
146	0.14
147	0.13
148	0.13
149	0.1
150	0.11
151	0.1
152	0.09
153	0.09
154	0.07
155	0.07
156	0.09
157	0.09
158	0.11
159	0.12
160	0.12
161	0.17
162	0.17
163	0.17
164	0.18
165	0.19
166	0.19
167	0.22
168	0.26
169	0.22
170	0.24
171	0.23
172	0.2
173	0.21
174	0.22
175	0.2
176	0.19
177	0.2
178	0.17
179	0.18
180	0.18
181	0.15
182	0.14
183	0.12
184	0.09
185	0.08
186	0.08
187	0.07
188	0.07
189	0.07
190	0.06
191	0.07
192	0.1
193	0.1
194	0.09
195	0.12
196	0.16
197	0.17
198	0.17
199	0.17
200	0.15
201	0.15
202	0.15
203	0.11
204	0.07
205	0.06
206	0.05
207	0.04
208	0.04
209	0.03
210	0.04
211	0.08
212	0.1
213	0.14
214	0.2
215	0.23
216	0.28
217	0.3
218	0.37
219	0.4
220	0.49
221	0.49
222	0.5
223	0.53
224	0.49
225	0.47
226	0.41
227	0.38
228	0.35
229	0.36
230	0.37
231	0.33
232	0.34
233	0.38
234	0.39
235	0.36
236	0.31
237	0.28
238	0.21
239	0.2
240	0.17
241	0.12
242	0.11
243	0.09
244	0.07
245	0.05
246	0.04
247	0.03
248	0.03
249	0.03
250	0.03
251	0.03
252	0.04
253	0.05
254	0.06
255	0.07
256	0.07
257	0.08
258	0.08
259	0.09
260	0.09
261	0.08
262	0.08
263	0.09
264	0.11
265	0.13
266	0.13
267	0.12
268	0.11
269	0.13
270	0.12
271	0.11
272	0.09
273	0.07
274	0.07
275	0.07
276	0.06
277	0.05
278	0.05
279	0.04
280	0.04
281	0.04
282	0.05
283	0.07
284	0.07
285	0.07
286	0.06
287	0.06
288	0.06
289	0.05
290	0.04
291	0.03
292	0.03
293	0.03
294	0.03
295	0.03
296	0.04
297	0.05
298	0.07
299	0.07
300	0.08
301	0.1
302	0.11
303	0.12
304	0.13
305	0.14
306	0.13
307	0.13
308	0.13
309	0.11
310	0.12
311	0.12
312	0.12
313	0.1
314	0.11
315	0.12
316	0.12
317	0.13
318	0.14
319	0.13
320	0.15
321	0.15
322	0.14
323	0.13
324	0.13
325	0.12
326	0.1
327	0.1
328	0.08
329	0.09
330	0.09
331	0.08
332	0.08
333	0.08
334	0.08
335	0.08
336	0.07
337	0.06
338	0.08
339	0.08
340	0.08
341	0.08
342	0.08
343	0.07
344	0.07
345	0.07
346	0.05
347	0.05
348	0.05
349	0.05
350	0.04
351	0.04
352	0.04
353	0.04
354	0.04
355	0.05
356	0.05
357	0.05
358	0.05
359	0.06
360	0.09
361	0.11
362	0.13
363	0.19
364	0.22
365	0.26
366	0.3
367	0.33
368	0.3
369	0.28
370	0.27
371	0.21
372	0.18
373	0.14
374	0.1
375	0.08
376	0.08
377	0.08
378	0.08
379	0.07
380	0.06
381	0.07
382	0.06
383	0.06
384	0.05
385	0.07
386	0.09
387	0.12
388	0.12
389	0.12
390	0.12
391	0.12
392	0.13
393	0.12
394	0.14
395	0.17
396	0.19
397	0.23
398	0.29
399	0.32
400	0.38
401	0.41
402	0.39
403	0.41
404	0.4
405	0.41
406	0.36
407	0.34
408	0.27
409	0.23
410	0.21
411	0.12
412	0.11
413	0.06
414	0.05
415	0.05
416	0.04
417	0.04
418	0.04
419	0.04
420	0.04
421	0.06
422	0.06
423	0.07
424	0.07
425	0.09
426	0.1
427	0.11
428	0.13
429	0.17
430	0.2
431	0.2
432	0.19
433	0.2
434	0.19
435	0.2
436	0.2
437	0.17
438	0.15
439	0.18
440	0.21
441	0.2
442	0.21
443	0.23
444	0.23
445	0.24
446	0.31
447	0.37
448	0.39
449	0.45
450	0.47
451	0.47
452	0.48

A0A238FEB0

3D AlphaFold-predicted Structure Viewer