Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G8ZS72

Protein Details
Accession G8ZS72    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MAAPRETKKRTTRRKKDPNAPKRALSHydrophilic
NLS Segment(s)
PositionSequence
6-23ETKKRTTRRKKDPNAPKR
Subcellular Location(s) nucl 19, cyto_nucl 12.5, mito 4, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
KEGG tdl:TDEL_0C04750  -  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MAAPRETKKRTTRRKKDPNAPKRALSAYMFFANENRDIVRSENPDVTFGQVGRLLGERWKALTPDEKTPYESKAEADKKRYESEKELYNATRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.94
3 0.94
4 0.95
5 0.94
6 0.93
7 0.87
8 0.78
9 0.71
10 0.63
11 0.56
12 0.47
13 0.38
14 0.31
15 0.28
16 0.25
17 0.21
18 0.2
19 0.18
20 0.17
21 0.15
22 0.12
23 0.11
24 0.11
25 0.13
26 0.16
27 0.17
28 0.18
29 0.21
30 0.21
31 0.21
32 0.2
33 0.2
34 0.16
35 0.13
36 0.12
37 0.09
38 0.09
39 0.08
40 0.09
41 0.08
42 0.1
43 0.11
44 0.1
45 0.11
46 0.13
47 0.13
48 0.14
49 0.21
50 0.23
51 0.29
52 0.34
53 0.33
54 0.36
55 0.37
56 0.38
57 0.33
58 0.31
59 0.25
60 0.3
61 0.37
62 0.4
63 0.44
64 0.49
65 0.5
66 0.56
67 0.59
68 0.55
69 0.53
70 0.52
71 0.54
72 0.5
73 0.51