Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A238F4D8

Protein Details
Accession A0A238F4D8   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
185-216LKRIVQEEKTEKKKQKKEDKLKGKGKGKEKEMBasic
NLS Segment(s)
PositionSequence
179-226KGLKKDLKRIVQEEKTEKKKQKKEDKLKGKGKGKEKEMEKEKEKEKRD
Subcellular Location(s) nucl 15.5, cyto_nucl 10.5, mito 9
Family & Domain DBs
Amino Acid Sequences MKLPLLPKLKNTSVPQRPEPSSPLLVTPQTSPTHPSFRADTTQADSTRLIKGSEASASDEGSTPTTSTSSRSGSISSASYHDLGACSSSFVIAIEEAHNPFRSPKPNTLDYTASPDLGPTIRHPIRSEGTNSQTVIAPFIDQAIDGQDRIQGLRIKVDEATLKEDEFKRLWKESKYVVKGLKKDLKRIVQEEKTEKKKQKKEDKLKGKGKGKEKEMEKEKEKEKRDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.67
3 0.67
4 0.66
5 0.62
6 0.6
7 0.55
8 0.5
9 0.44
10 0.39
11 0.35
12 0.33
13 0.3
14 0.28
15 0.27
16 0.24
17 0.25
18 0.26
19 0.27
20 0.33
21 0.33
22 0.34
23 0.32
24 0.34
25 0.37
26 0.35
27 0.33
28 0.31
29 0.36
30 0.33
31 0.32
32 0.3
33 0.27
34 0.28
35 0.26
36 0.21
37 0.16
38 0.16
39 0.16
40 0.16
41 0.15
42 0.16
43 0.15
44 0.15
45 0.15
46 0.14
47 0.14
48 0.13
49 0.12
50 0.09
51 0.09
52 0.1
53 0.09
54 0.11
55 0.14
56 0.14
57 0.15
58 0.16
59 0.16
60 0.16
61 0.17
62 0.16
63 0.14
64 0.13
65 0.13
66 0.13
67 0.12
68 0.11
69 0.1
70 0.09
71 0.09
72 0.07
73 0.06
74 0.06
75 0.05
76 0.05
77 0.05
78 0.05
79 0.04
80 0.05
81 0.06
82 0.07
83 0.08
84 0.1
85 0.1
86 0.1
87 0.12
88 0.15
89 0.2
90 0.23
91 0.29
92 0.33
93 0.38
94 0.4
95 0.41
96 0.4
97 0.34
98 0.38
99 0.31
100 0.26
101 0.21
102 0.18
103 0.15
104 0.14
105 0.14
106 0.07
107 0.16
108 0.16
109 0.18
110 0.19
111 0.22
112 0.24
113 0.25
114 0.28
115 0.24
116 0.27
117 0.28
118 0.27
119 0.24
120 0.23
121 0.21
122 0.18
123 0.13
124 0.1
125 0.08
126 0.08
127 0.07
128 0.05
129 0.05
130 0.07
131 0.07
132 0.07
133 0.07
134 0.08
135 0.08
136 0.09
137 0.13
138 0.13
139 0.13
140 0.18
141 0.18
142 0.18
143 0.18
144 0.2
145 0.19
146 0.17
147 0.22
148 0.18
149 0.18
150 0.22
151 0.23
152 0.25
153 0.23
154 0.26
155 0.26
156 0.31
157 0.36
158 0.34
159 0.37
160 0.42
161 0.5
162 0.5
163 0.52
164 0.54
165 0.56
166 0.57
167 0.63
168 0.63
169 0.56
170 0.6
171 0.62
172 0.63
173 0.62
174 0.64
175 0.64
176 0.62
177 0.67
178 0.68
179 0.69
180 0.7
181 0.73
182 0.76
183 0.77
184 0.78
185 0.81
186 0.84
187 0.85
188 0.88
189 0.9
190 0.92
191 0.92
192 0.93
193 0.92
194 0.9
195 0.87
196 0.85
197 0.83
198 0.78
199 0.77
200 0.74
201 0.74
202 0.74
203 0.75
204 0.72
205 0.72
206 0.74
207 0.75