Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A238FCC0

Protein Details
Accession A0A238FCC0    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
94-113LRRNPFKKTRPTSVKNRCTEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, cyto 8, nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR001209  Ribosomal_S14  
IPR043140  Ribosomal_S14/S29  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00253  Ribosomal_S14  
Amino Acid Sequences MPRPLPGHMALKDFRTRKQVAANELLRRAYLYLYRNTTVDPKIRTQAMLKLNAFTKDVRSMQAALRTRVTLISTLLTCTPYIFVHPRLPLFPALRRNPFKKTRPTSVKNRCTETGRGGGVLSEFGLCRHRFKLAAEKGDIPGVSRAAW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.44
3 0.44
4 0.42
5 0.5
6 0.5
7 0.48
8 0.54
9 0.56
10 0.53
11 0.53
12 0.5
13 0.4
14 0.35
15 0.3
16 0.22
17 0.22
18 0.2
19 0.23
20 0.27
21 0.28
22 0.28
23 0.29
24 0.31
25 0.3
26 0.32
27 0.29
28 0.28
29 0.31
30 0.31
31 0.31
32 0.29
33 0.32
34 0.32
35 0.35
36 0.32
37 0.31
38 0.32
39 0.32
40 0.31
41 0.24
42 0.21
43 0.19
44 0.2
45 0.19
46 0.18
47 0.18
48 0.19
49 0.26
50 0.26
51 0.23
52 0.23
53 0.22
54 0.21
55 0.19
56 0.18
57 0.11
58 0.09
59 0.09
60 0.08
61 0.08
62 0.09
63 0.09
64 0.08
65 0.07
66 0.08
67 0.07
68 0.09
69 0.11
70 0.13
71 0.17
72 0.18
73 0.19
74 0.19
75 0.2
76 0.22
77 0.22
78 0.24
79 0.29
80 0.33
81 0.41
82 0.46
83 0.48
84 0.53
85 0.59
86 0.61
87 0.64
88 0.65
89 0.67
90 0.71
91 0.75
92 0.78
93 0.8
94 0.82
95 0.77
96 0.76
97 0.69
98 0.63
99 0.6
100 0.54
101 0.48
102 0.39
103 0.34
104 0.28
105 0.25
106 0.21
107 0.17
108 0.12
109 0.07
110 0.07
111 0.08
112 0.14
113 0.15
114 0.18
115 0.19
116 0.22
117 0.23
118 0.27
119 0.37
120 0.39
121 0.45
122 0.45
123 0.46
124 0.45
125 0.47
126 0.43
127 0.34
128 0.29