Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A238F6L9

Protein Details
Accession A0A238F6L9    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
92-111TELVSDSTKDKKRSKKHKKABasic
NLS Segment(s)
PositionSequence
86-90GKKRK
99-111TKDKKRSKKHKKA
Subcellular Location(s) nucl 14.5, mito 12, cyto_nucl 8
Family & Domain DBs
Amino Acid Sequences MDLAPLPAPLHLRPLRIRPVPSSSAIIEMQRFLADKTATRVLSGSGASAIKEALVRLVKRLEQEQLEASSAAGAQVESNSSSSEKGKKRKVTELVSDSTKDKKRSKKHKKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.46
3 0.48
4 0.51
5 0.46
6 0.5
7 0.48
8 0.46
9 0.43
10 0.34
11 0.32
12 0.3
13 0.27
14 0.21
15 0.18
16 0.16
17 0.13
18 0.13
19 0.1
20 0.13
21 0.12
22 0.12
23 0.16
24 0.21
25 0.2
26 0.2
27 0.2
28 0.16
29 0.17
30 0.16
31 0.11
32 0.08
33 0.08
34 0.08
35 0.08
36 0.07
37 0.06
38 0.06
39 0.05
40 0.07
41 0.09
42 0.09
43 0.11
44 0.13
45 0.14
46 0.15
47 0.17
48 0.17
49 0.15
50 0.16
51 0.16
52 0.16
53 0.15
54 0.14
55 0.12
56 0.1
57 0.09
58 0.07
59 0.05
60 0.04
61 0.03
62 0.04
63 0.05
64 0.05
65 0.06
66 0.07
67 0.08
68 0.09
69 0.13
70 0.21
71 0.28
72 0.37
73 0.46
74 0.53
75 0.58
76 0.66
77 0.72
78 0.7
79 0.72
80 0.68
81 0.64
82 0.59
83 0.56
84 0.49
85 0.49
86 0.49
87 0.48
88 0.5
89 0.56
90 0.63
91 0.73