Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A238FL27

Protein Details
Accession A0A238FL27    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
133-153TIILVPKNLRKSRRKSLKHTGHydrophilic
NLS Segment(s)
PositionSequence
142-150RKSRRKSLK
Subcellular Location(s) nucl 19.5, cyto_nucl 13, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036691  Endo/exonu/phosph_ase_sf  
Amino Acid Sequences MWEADVFLLSETGRPTPERVAQWTQECRDLKLSALFTPLDNTAILWKSDSPVVTIDPESPSNFLRASFAFPARISDATFRVGDSKVRVVSTCAPSSDKPDKKRLLSHLSTTLRRAMCDGPSFFIYLIDFNNSTIILVPKNLRKSRRKSLKHTG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.16
3 0.21
4 0.27
5 0.29
6 0.33
7 0.38
8 0.42
9 0.48
10 0.52
11 0.49
12 0.51
13 0.49
14 0.45
15 0.43
16 0.38
17 0.33
18 0.31
19 0.3
20 0.23
21 0.24
22 0.22
23 0.18
24 0.19
25 0.18
26 0.13
27 0.12
28 0.11
29 0.12
30 0.13
31 0.13
32 0.11
33 0.11
34 0.11
35 0.13
36 0.13
37 0.11
38 0.11
39 0.11
40 0.12
41 0.12
42 0.13
43 0.13
44 0.14
45 0.13
46 0.14
47 0.13
48 0.13
49 0.13
50 0.11
51 0.11
52 0.11
53 0.13
54 0.14
55 0.14
56 0.14
57 0.14
58 0.16
59 0.15
60 0.15
61 0.13
62 0.12
63 0.12
64 0.13
65 0.13
66 0.11
67 0.12
68 0.12
69 0.12
70 0.12
71 0.14
72 0.13
73 0.14
74 0.14
75 0.14
76 0.2
77 0.22
78 0.22
79 0.2
80 0.22
81 0.22
82 0.3
83 0.37
84 0.38
85 0.39
86 0.47
87 0.52
88 0.52
89 0.58
90 0.58
91 0.57
92 0.53
93 0.52
94 0.53
95 0.53
96 0.51
97 0.47
98 0.46
99 0.37
100 0.34
101 0.33
102 0.26
103 0.25
104 0.28
105 0.27
106 0.24
107 0.25
108 0.25
109 0.22
110 0.21
111 0.17
112 0.13
113 0.13
114 0.13
115 0.12
116 0.12
117 0.13
118 0.12
119 0.11
120 0.12
121 0.13
122 0.1
123 0.13
124 0.18
125 0.25
126 0.35
127 0.42
128 0.49
129 0.57
130 0.66
131 0.74
132 0.8
133 0.82