Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8ZTX7

Protein Details
Accession G8ZTX7   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
134-153KGAKYMRKLEEKKKANAKTWHydrophilic
NLS Segment(s)
PositionSequence
140-147RKLEEKKK
Subcellular Location(s) mito 15, nucl 6.5, cyto_nucl 6.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR037507  MrpL25  
IPR040922  MRPL25_dom  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
KEGG tdl:TDEL_0D04870  -  
Pfam View protein in Pfam  
PF18126  Mitoc_mL59  
Amino Acid Sequences MSTKHLFDQLPAQLKNFFKKYPPSIKFADKPVSTHAIEANPFLPNKHPVTGRYHEPKYSLRRSSDLYKMAYLYGVQNMLPPMKKKFFEEKYENKKMMKGVLLPKGHKHELQREGKIAKMQEAIKNADKFIIDAKGAKYMRKLEEKKKANAKTWF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.48
3 0.45
4 0.4
5 0.37
6 0.45
7 0.52
8 0.57
9 0.57
10 0.54
11 0.55
12 0.62
13 0.6
14 0.58
15 0.58
16 0.47
17 0.46
18 0.45
19 0.46
20 0.37
21 0.34
22 0.3
23 0.24
24 0.24
25 0.23
26 0.2
27 0.17
28 0.16
29 0.16
30 0.17
31 0.19
32 0.2
33 0.23
34 0.24
35 0.24
36 0.32
37 0.35
38 0.4
39 0.43
40 0.43
41 0.4
42 0.42
43 0.46
44 0.47
45 0.51
46 0.48
47 0.42
48 0.42
49 0.45
50 0.46
51 0.45
52 0.4
53 0.34
54 0.3
55 0.28
56 0.25
57 0.21
58 0.17
59 0.11
60 0.09
61 0.07
62 0.07
63 0.07
64 0.08
65 0.09
66 0.1
67 0.11
68 0.15
69 0.18
70 0.19
71 0.23
72 0.31
73 0.35
74 0.42
75 0.48
76 0.54
77 0.6
78 0.66
79 0.65
80 0.56
81 0.53
82 0.46
83 0.41
84 0.33
85 0.29
86 0.28
87 0.34
88 0.37
89 0.36
90 0.4
91 0.44
92 0.44
93 0.42
94 0.4
95 0.41
96 0.47
97 0.53
98 0.51
99 0.5
100 0.49
101 0.48
102 0.47
103 0.39
104 0.32
105 0.3
106 0.3
107 0.29
108 0.32
109 0.35
110 0.38
111 0.38
112 0.35
113 0.32
114 0.28
115 0.25
116 0.24
117 0.22
118 0.16
119 0.18
120 0.19
121 0.26
122 0.26
123 0.28
124 0.31
125 0.34
126 0.4
127 0.48
128 0.55
129 0.56
130 0.66
131 0.72
132 0.76
133 0.8
134 0.8