Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A238FF92

Protein Details
Accession A0A238FF92    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
25-55SYASLRMPKEAKRRWRKHKGHKEEKDEEEDEBasic
NLS Segment(s)
PositionSequence
32-46PKEAKRRWRKHKGHK
Subcellular Location(s) plas 18, E.R. 4, pero 2, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR007369  Peptidase_A22B_SPP  
IPR006639  Preselin/SPP  
Gene Ontology GO:0016020  C:membrane  
GO:0004190  F:aspartic-type endopeptidase activity  
Pfam View protein in Pfam  
PF04258  Peptidase_A22B  
Amino Acid Sequences MANVGEFFAFGSIILLATVTIYSASYASLRMPKEAKRRWRKHKGHKEEKDEEEDEGEDEEEDEVVDRLIAQDAYLFPILGSVVLFSLYLAFTLLNKEMINRVLGAYLALIGVGAVAKVLGSGVKVGLGKKTFKGLVKWKISMYKGKKEYASLGFTVLDLVALVLGLGLQALQIYKPFWILSNIVALSFAFGAISLMRLDSFWTGSALLGLLFFYDVWWVFGSNAVFGANVMVTVATSFDAPIKITFPRTFLEPVYALQGKDFMLLGLGDIVLPGIFVALSLRWDYHRALKREVGGPPKPDMGWGSSGWEERWDRPYFRATMAAYVLGLITTITMMHQFKAAQPALLYLSPACIIAVCGTAWRRDEWKQFWAFDDASDDEPSKEKKEDEDKDGKEGDEKAVEEDETPRRSSLRSRSSGAASDGEGEKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.05
4 0.05
5 0.05
6 0.04
7 0.04
8 0.04
9 0.05
10 0.05
11 0.07
12 0.07
13 0.08
14 0.12
15 0.18
16 0.19
17 0.24
18 0.28
19 0.36
20 0.46
21 0.55
22 0.62
23 0.67
24 0.77
25 0.83
26 0.9
27 0.92
28 0.93
29 0.95
30 0.96
31 0.96
32 0.95
33 0.94
34 0.91
35 0.86
36 0.83
37 0.73
38 0.62
39 0.53
40 0.43
41 0.34
42 0.26
43 0.2
44 0.12
45 0.11
46 0.1
47 0.08
48 0.07
49 0.07
50 0.06
51 0.06
52 0.05
53 0.05
54 0.05
55 0.07
56 0.07
57 0.06
58 0.08
59 0.08
60 0.12
61 0.12
62 0.11
63 0.09
64 0.1
65 0.1
66 0.08
67 0.08
68 0.05
69 0.04
70 0.05
71 0.05
72 0.04
73 0.05
74 0.05
75 0.05
76 0.05
77 0.05
78 0.05
79 0.08
80 0.09
81 0.1
82 0.1
83 0.11
84 0.13
85 0.14
86 0.15
87 0.12
88 0.12
89 0.11
90 0.1
91 0.09
92 0.07
93 0.06
94 0.05
95 0.04
96 0.04
97 0.03
98 0.03
99 0.03
100 0.03
101 0.02
102 0.02
103 0.02
104 0.02
105 0.02
106 0.03
107 0.03
108 0.04
109 0.04
110 0.06
111 0.08
112 0.09
113 0.13
114 0.16
115 0.18
116 0.18
117 0.23
118 0.25
119 0.26
120 0.32
121 0.37
122 0.44
123 0.47
124 0.49
125 0.47
126 0.49
127 0.5
128 0.53
129 0.5
130 0.51
131 0.5
132 0.51
133 0.5
134 0.45
135 0.47
136 0.42
137 0.38
138 0.29
139 0.25
140 0.22
141 0.2
142 0.19
143 0.13
144 0.08
145 0.05
146 0.04
147 0.03
148 0.02
149 0.02
150 0.02
151 0.02
152 0.02
153 0.02
154 0.02
155 0.02
156 0.02
157 0.02
158 0.03
159 0.04
160 0.04
161 0.05
162 0.06
163 0.06
164 0.06
165 0.09
166 0.09
167 0.09
168 0.12
169 0.12
170 0.11
171 0.11
172 0.1
173 0.08
174 0.07
175 0.06
176 0.03
177 0.03
178 0.03
179 0.03
180 0.04
181 0.03
182 0.04
183 0.04
184 0.04
185 0.05
186 0.05
187 0.06
188 0.05
189 0.06
190 0.06
191 0.06
192 0.06
193 0.05
194 0.04
195 0.04
196 0.03
197 0.03
198 0.03
199 0.03
200 0.03
201 0.03
202 0.03
203 0.04
204 0.04
205 0.05
206 0.05
207 0.07
208 0.07
209 0.07
210 0.07
211 0.06
212 0.06
213 0.05
214 0.06
215 0.03
216 0.03
217 0.03
218 0.03
219 0.02
220 0.03
221 0.03
222 0.03
223 0.03
224 0.03
225 0.04
226 0.05
227 0.06
228 0.06
229 0.07
230 0.08
231 0.12
232 0.13
233 0.14
234 0.14
235 0.16
236 0.18
237 0.16
238 0.18
239 0.15
240 0.15
241 0.18
242 0.19
243 0.16
244 0.14
245 0.15
246 0.12
247 0.12
248 0.12
249 0.07
250 0.06
251 0.05
252 0.05
253 0.04
254 0.04
255 0.03
256 0.03
257 0.03
258 0.02
259 0.02
260 0.02
261 0.02
262 0.02
263 0.02
264 0.03
265 0.03
266 0.04
267 0.05
268 0.06
269 0.07
270 0.1
271 0.11
272 0.2
273 0.27
274 0.3
275 0.33
276 0.36
277 0.39
278 0.42
279 0.45
280 0.44
281 0.41
282 0.41
283 0.39
284 0.38
285 0.34
286 0.3
287 0.27
288 0.21
289 0.19
290 0.17
291 0.17
292 0.17
293 0.18
294 0.17
295 0.21
296 0.21
297 0.21
298 0.28
299 0.28
300 0.28
301 0.3
302 0.35
303 0.32
304 0.31
305 0.33
306 0.27
307 0.27
308 0.26
309 0.23
310 0.18
311 0.15
312 0.14
313 0.08
314 0.07
315 0.04
316 0.03
317 0.03
318 0.03
319 0.03
320 0.08
321 0.09
322 0.09
323 0.11
324 0.12
325 0.14
326 0.22
327 0.23
328 0.19
329 0.19
330 0.2
331 0.21
332 0.21
333 0.19
334 0.11
335 0.12
336 0.11
337 0.11
338 0.09
339 0.07
340 0.07
341 0.07
342 0.08
343 0.07
344 0.11
345 0.12
346 0.16
347 0.17
348 0.19
349 0.23
350 0.29
351 0.38
352 0.39
353 0.46
354 0.48
355 0.48
356 0.48
357 0.49
358 0.42
359 0.33
360 0.33
361 0.27
362 0.25
363 0.25
364 0.23
365 0.19
366 0.23
367 0.26
368 0.25
369 0.26
370 0.24
371 0.31
372 0.4
373 0.46
374 0.5
375 0.57
376 0.55
377 0.58
378 0.59
379 0.51
380 0.45
381 0.41
382 0.35
383 0.29
384 0.27
385 0.24
386 0.24
387 0.23
388 0.2
389 0.25
390 0.29
391 0.28
392 0.29
393 0.28
394 0.28
395 0.31
396 0.38
397 0.42
398 0.45
399 0.48
400 0.5
401 0.54
402 0.57
403 0.58
404 0.52
405 0.43
406 0.34
407 0.32