Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8ZLR3

Protein Details
Accession G8ZLR3    Localization Confidence High Confidence Score 20.5
NoLS Segment(s)
PositionSequenceProtein Nature
28-47ISYKCKSKSTQKKPVVSFKTHydrophilic
87-112KRAMKPVTKKLGKKNKKKAHVKDVVGBasic
132-155TTKQTEATSSKKKKQNKNRGKKKRBasic
NLS Segment(s)
PositionSequence
82-106RGKIEKRAMKPVTKKLGKKNKKKAH
142-155KKKKQNKNRGKKKR
Subcellular Location(s) nucl 19.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR039432  SRP9_dom  
KEGG tdl:TDEL_0A02250  -  
Pfam View protein in Pfam  
PF05486  SRP9-21  
Amino Acid Sequences MSVKPIDTFITNSVQLFEANPSQTIFSISYKCKSKSTQKKPVVSFKTHNSHLSNHYKFKTNKSKDVSRLLSALGPRGVSITRGKIEKRAMKPVTKKLGKKNKKKAHVKDVVGLSTLMVNTDVKEYVPVVEETTKQTEATSSKKKKQNKNRGKKKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.18
3 0.17
4 0.17
5 0.16
6 0.17
7 0.17
8 0.16
9 0.17
10 0.16
11 0.18
12 0.17
13 0.16
14 0.2
15 0.22
16 0.28
17 0.34
18 0.36
19 0.38
20 0.42
21 0.51
22 0.56
23 0.64
24 0.69
25 0.71
26 0.78
27 0.8
28 0.83
29 0.79
30 0.74
31 0.68
32 0.65
33 0.63
34 0.58
35 0.56
36 0.48
37 0.45
38 0.46
39 0.51
40 0.47
41 0.46
42 0.45
43 0.49
44 0.48
45 0.55
46 0.58
47 0.53
48 0.57
49 0.58
50 0.63
51 0.6
52 0.66
53 0.59
54 0.5
55 0.45
56 0.37
57 0.32
58 0.25
59 0.22
60 0.14
61 0.11
62 0.09
63 0.09
64 0.09
65 0.09
66 0.1
67 0.11
68 0.12
69 0.15
70 0.15
71 0.2
72 0.27
73 0.33
74 0.35
75 0.42
76 0.44
77 0.49
78 0.55
79 0.58
80 0.62
81 0.61
82 0.63
83 0.64
84 0.72
85 0.74
86 0.79
87 0.81
88 0.81
89 0.84
90 0.89
91 0.88
92 0.88
93 0.87
94 0.78
95 0.74
96 0.67
97 0.58
98 0.48
99 0.39
100 0.28
101 0.19
102 0.17
103 0.1
104 0.08
105 0.07
106 0.07
107 0.09
108 0.09
109 0.08
110 0.09
111 0.09
112 0.09
113 0.11
114 0.11
115 0.12
116 0.14
117 0.15
118 0.19
119 0.23
120 0.23
121 0.21
122 0.2
123 0.22
124 0.24
125 0.31
126 0.38
127 0.43
128 0.52
129 0.6
130 0.7
131 0.76
132 0.84
133 0.87
134 0.87
135 0.9