Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A238FA94

Protein Details
Accession A0A238FA94    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
3-23VKIPIVKKRVKPFIRHQSDRYHydrophilic
27-46KAAWRKPKGIDNRVRRRFKGBasic
NLS Segment(s)
PositionSequence
10-18KRVKPFIRH
22-46RYAGVKAAWRKPKGIDNRVRRRFKG
Subcellular Location(s) cyto 11.5, mito 11, cyto_nucl 8.5, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAVKIPIVKKRVKPFIRHQSDRYAGVKAAWRKPKGIDNRVRRRFKGQLSMPKIGYGSNKKTRHVMPNGYRRFLVNNTRELELLLMHNGSYAAEIAHGVSSRKRIEIVEKARVLGVKLTNGNARVRTEEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.8
3 0.82
4 0.81
5 0.74
6 0.73
7 0.7
8 0.66
9 0.57
10 0.48
11 0.38
12 0.34
13 0.38
14 0.35
15 0.4
16 0.44
17 0.44
18 0.43
19 0.47
20 0.52
21 0.56
22 0.58
23 0.6
24 0.62
25 0.71
26 0.79
27 0.82
28 0.76
29 0.73
30 0.71
31 0.66
32 0.65
33 0.62
34 0.62
35 0.62
36 0.64
37 0.57
38 0.5
39 0.45
40 0.36
41 0.34
42 0.3
43 0.31
44 0.36
45 0.39
46 0.39
47 0.43
48 0.45
49 0.47
50 0.46
51 0.47
52 0.46
53 0.54
54 0.56
55 0.53
56 0.49
57 0.42
58 0.39
59 0.35
60 0.36
61 0.28
62 0.31
63 0.31
64 0.32
65 0.31
66 0.29
67 0.25
68 0.16
69 0.14
70 0.09
71 0.07
72 0.06
73 0.06
74 0.06
75 0.06
76 0.05
77 0.05
78 0.04
79 0.04
80 0.04
81 0.04
82 0.05
83 0.06
84 0.07
85 0.09
86 0.15
87 0.16
88 0.17
89 0.18
90 0.18
91 0.25
92 0.34
93 0.39
94 0.43
95 0.42
96 0.42
97 0.43
98 0.42
99 0.36
100 0.31
101 0.26
102 0.23
103 0.24
104 0.26
105 0.29
106 0.31
107 0.35
108 0.33
109 0.33