Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A238F9P8

Protein Details
Accession A0A238F9P8    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
367-394LKAFVTKPLKAKPAKKKTTEKKADEATAHydrophilic
NLS Segment(s)
PositionSequence
374-388PLKAKPAKKKTTEKK
Subcellular Location(s) cyto 22, nucl 4.5, mito_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036005  Creatinase/aminopeptidase-like  
IPR047113  PA2G4/ARX1  
IPR000994  Pept_M24  
IPR036388  WH-like_DNA-bd_sf  
IPR036390  WH_DNA-bd_sf  
Pfam View protein in Pfam  
PF00557  Peptidase_M24  
Amino Acid Sequences MPAAKVEAATAEAPVSFRHEHESVLDKYKAAGTVVSSALQSLIPKCVEGANVLELCVEGDKLIEAATAGLYNKVKGLPKGVAFPTSLSINSNLQNYNPLPSDKSATATTLAQNDLVKICLGAHIDGYAVVAAETIVVGSTPIKEVRADLLSAAHYAAEAALRVVKSGIKNWEITDAIKKVLAEYDSAGVKGVEGVLSHQHEQNSIEAKKGIVAFPSMSQRADSDNAYLLEEGEVYGLNILVTNGEKAFKTADRSATTIFSKTSTTYNLKMKTSRATFSEITKKAGPFPFTLRVLEEEAKARMGVKECVDHNLLKPYELLTTDKASDLSAQVFMTFAVTKTGMTRLSLAPTWFSEDKVQGTVTLSDELKAFVTKPLKAKPAKKKTTEKKADEATA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.16
3 0.15
4 0.15
5 0.21
6 0.21
7 0.22
8 0.25
9 0.31
10 0.31
11 0.36
12 0.36
13 0.3
14 0.31
15 0.33
16 0.3
17 0.24
18 0.2
19 0.15
20 0.18
21 0.19
22 0.18
23 0.15
24 0.14
25 0.14
26 0.14
27 0.14
28 0.12
29 0.15
30 0.15
31 0.15
32 0.16
33 0.16
34 0.16
35 0.16
36 0.16
37 0.17
38 0.17
39 0.17
40 0.16
41 0.14
42 0.14
43 0.13
44 0.1
45 0.05
46 0.05
47 0.05
48 0.05
49 0.05
50 0.05
51 0.04
52 0.05
53 0.05
54 0.06
55 0.06
56 0.11
57 0.11
58 0.12
59 0.13
60 0.16
61 0.2
62 0.2
63 0.24
64 0.24
65 0.25
66 0.31
67 0.31
68 0.3
69 0.27
70 0.27
71 0.24
72 0.21
73 0.2
74 0.15
75 0.16
76 0.17
77 0.19
78 0.21
79 0.19
80 0.18
81 0.23
82 0.22
83 0.23
84 0.22
85 0.22
86 0.21
87 0.22
88 0.26
89 0.21
90 0.23
91 0.2
92 0.2
93 0.2
94 0.19
95 0.2
96 0.18
97 0.18
98 0.16
99 0.16
100 0.16
101 0.14
102 0.13
103 0.11
104 0.09
105 0.08
106 0.09
107 0.09
108 0.08
109 0.08
110 0.08
111 0.08
112 0.07
113 0.07
114 0.05
115 0.04
116 0.04
117 0.03
118 0.03
119 0.03
120 0.03
121 0.02
122 0.02
123 0.02
124 0.03
125 0.03
126 0.04
127 0.05
128 0.06
129 0.07
130 0.07
131 0.08
132 0.11
133 0.12
134 0.11
135 0.1
136 0.11
137 0.11
138 0.11
139 0.1
140 0.07
141 0.05
142 0.05
143 0.05
144 0.04
145 0.03
146 0.03
147 0.05
148 0.05
149 0.06
150 0.06
151 0.09
152 0.09
153 0.13
154 0.17
155 0.17
156 0.18
157 0.19
158 0.21
159 0.2
160 0.2
161 0.21
162 0.18
163 0.16
164 0.16
165 0.16
166 0.13
167 0.14
168 0.13
169 0.09
170 0.09
171 0.1
172 0.1
173 0.1
174 0.1
175 0.07
176 0.07
177 0.06
178 0.05
179 0.04
180 0.03
181 0.04
182 0.07
183 0.09
184 0.1
185 0.12
186 0.12
187 0.12
188 0.13
189 0.15
190 0.18
191 0.17
192 0.17
193 0.16
194 0.15
195 0.17
196 0.17
197 0.15
198 0.09
199 0.1
200 0.09
201 0.11
202 0.15
203 0.14
204 0.13
205 0.13
206 0.13
207 0.15
208 0.16
209 0.14
210 0.11
211 0.13
212 0.13
213 0.13
214 0.12
215 0.1
216 0.08
217 0.08
218 0.07
219 0.05
220 0.04
221 0.03
222 0.04
223 0.03
224 0.03
225 0.03
226 0.03
227 0.04
228 0.04
229 0.05
230 0.05
231 0.06
232 0.06
233 0.07
234 0.09
235 0.1
236 0.15
237 0.18
238 0.23
239 0.24
240 0.26
241 0.27
242 0.28
243 0.27
244 0.23
245 0.2
246 0.17
247 0.16
248 0.15
249 0.16
250 0.18
251 0.21
252 0.25
253 0.31
254 0.34
255 0.36
256 0.37
257 0.38
258 0.41
259 0.4
260 0.38
261 0.33
262 0.35
263 0.33
264 0.37
265 0.44
266 0.37
267 0.38
268 0.4
269 0.38
270 0.39
271 0.41
272 0.37
273 0.3
274 0.34
275 0.36
276 0.34
277 0.35
278 0.3
279 0.28
280 0.3
281 0.29
282 0.25
283 0.21
284 0.2
285 0.2
286 0.19
287 0.17
288 0.16
289 0.17
290 0.19
291 0.18
292 0.22
293 0.22
294 0.26
295 0.28
296 0.27
297 0.26
298 0.32
299 0.3
300 0.26
301 0.25
302 0.22
303 0.22
304 0.22
305 0.22
306 0.16
307 0.19
308 0.19
309 0.2
310 0.19
311 0.17
312 0.17
313 0.16
314 0.14
315 0.13
316 0.12
317 0.11
318 0.11
319 0.1
320 0.11
321 0.1
322 0.09
323 0.1
324 0.1
325 0.11
326 0.12
327 0.16
328 0.15
329 0.15
330 0.18
331 0.17
332 0.22
333 0.24
334 0.23
335 0.22
336 0.22
337 0.28
338 0.26
339 0.26
340 0.26
341 0.26
342 0.27
343 0.27
344 0.26
345 0.2
346 0.22
347 0.22
348 0.2
349 0.21
350 0.19
351 0.18
352 0.18
353 0.17
354 0.16
355 0.15
356 0.14
357 0.17
358 0.22
359 0.26
360 0.33
361 0.39
362 0.48
363 0.55
364 0.65
365 0.69
366 0.75
367 0.81
368 0.84
369 0.87
370 0.89
371 0.92
372 0.92
373 0.88
374 0.86