Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8ZPY9

Protein Details
Accession G8ZPY9    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
226-249DLMKLRCKIAKVKKKPAKTEALDVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 13, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR026846  Nse2(Mms21)  
IPR003613  Ubox_domain  
IPR004181  Znf_MIZ  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0005634  C:nucleus  
GO:0030915  C:Smc5-Smc6 complex  
GO:0019789  F:SUMO transferase activity  
GO:0004842  F:ubiquitin-protein transferase activity  
GO:0008270  F:zinc ion binding  
GO:0000724  P:double-strand break repair via homologous recombination  
GO:0016925  P:protein sumoylation  
GO:0016567  P:protein ubiquitination  
KEGG tdl:TDEL_0B05540  -  
Pfam View protein in Pfam  
PF11789  zf-Nse  
PROSITE View protein in PROSITE  
PS51044  ZF_SP_RING  
CDD cd16651  SPL-RING_NSE2  
Amino Acid Sequences MSEIPQSLPVHPRTRQRLHELSVKDISDSYNDTRRQLFETLQSLLADPGDTIEDQMNTLIKNYQNLCTLQASSINLTARLANAKDSFRSLCEQCDPVDPLTWYQYASGELMAPRLAALFQEEQSVSKETRLSREDVLLSALKYIWNDPTAMIPDEQNDDLYIEGGKIELHCPITYKPFETPMISKKCNHVFDRLGIENYLHGYPSRDCPQSGCSQKLTMSDFQEDDLMKLRCKIAKVKKKPAKTEALDVI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.66
3 0.68
4 0.69
5 0.67
6 0.7
7 0.63
8 0.6
9 0.56
10 0.49
11 0.41
12 0.34
13 0.3
14 0.25
15 0.26
16 0.24
17 0.27
18 0.29
19 0.3
20 0.33
21 0.34
22 0.35
23 0.33
24 0.31
25 0.29
26 0.3
27 0.3
28 0.28
29 0.27
30 0.24
31 0.21
32 0.19
33 0.13
34 0.09
35 0.08
36 0.07
37 0.07
38 0.08
39 0.09
40 0.09
41 0.09
42 0.1
43 0.1
44 0.09
45 0.1
46 0.13
47 0.12
48 0.17
49 0.19
50 0.21
51 0.23
52 0.24
53 0.26
54 0.24
55 0.24
56 0.19
57 0.2
58 0.18
59 0.16
60 0.18
61 0.16
62 0.14
63 0.14
64 0.14
65 0.12
66 0.13
67 0.12
68 0.13
69 0.15
70 0.16
71 0.17
72 0.19
73 0.19
74 0.18
75 0.22
76 0.19
77 0.19
78 0.21
79 0.21
80 0.19
81 0.22
82 0.23
83 0.19
84 0.2
85 0.18
86 0.16
87 0.18
88 0.17
89 0.13
90 0.12
91 0.11
92 0.1
93 0.1
94 0.09
95 0.07
96 0.07
97 0.07
98 0.07
99 0.06
100 0.05
101 0.05
102 0.04
103 0.03
104 0.06
105 0.06
106 0.07
107 0.08
108 0.08
109 0.09
110 0.11
111 0.13
112 0.11
113 0.11
114 0.14
115 0.13
116 0.18
117 0.19
118 0.2
119 0.19
120 0.2
121 0.2
122 0.17
123 0.18
124 0.14
125 0.12
126 0.11
127 0.1
128 0.09
129 0.08
130 0.09
131 0.08
132 0.08
133 0.08
134 0.08
135 0.1
136 0.11
137 0.12
138 0.12
139 0.1
140 0.11
141 0.13
142 0.13
143 0.11
144 0.09
145 0.09
146 0.08
147 0.08
148 0.07
149 0.05
150 0.04
151 0.04
152 0.04
153 0.05
154 0.05
155 0.07
156 0.09
157 0.09
158 0.11
159 0.13
160 0.18
161 0.19
162 0.21
163 0.2
164 0.23
165 0.25
166 0.25
167 0.28
168 0.31
169 0.38
170 0.39
171 0.39
172 0.43
173 0.49
174 0.53
175 0.51
176 0.49
177 0.44
178 0.45
179 0.5
180 0.45
181 0.38
182 0.32
183 0.3
184 0.24
185 0.23
186 0.19
187 0.13
188 0.11
189 0.13
190 0.14
191 0.21
192 0.26
193 0.25
194 0.26
195 0.27
196 0.32
197 0.38
198 0.43
199 0.4
200 0.37
201 0.37
202 0.38
203 0.41
204 0.41
205 0.36
206 0.34
207 0.33
208 0.31
209 0.3
210 0.32
211 0.27
212 0.24
213 0.26
214 0.24
215 0.21
216 0.24
217 0.27
218 0.26
219 0.3
220 0.39
221 0.43
222 0.53
223 0.62
224 0.71
225 0.76
226 0.83
227 0.89
228 0.87
229 0.86
230 0.8