Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A238FII7

Protein Details
Accession A0A238FII7    Localization Confidence Low Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
5-24FLHMRCRAPLQRKIIRPREDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, cyto 4, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007135  Atg3/Atg10  
Gene Ontology GO:0019787  F:ubiquitin-like protein transferase activity  
GO:0006914  P:autophagy  
Pfam View protein in Pfam  
PF03987  Autophagy_act_C  
Amino Acid Sequences MLMSFLHMRCRAPLQRKIIRPREDSNPLEVDDPHDEHVGPTLEEPQDTSSLAEQGTAPNELCTLNLHVCWSPTYLVPVLYFTAHKQNGAPLQLLELFNSTVFQHIYYAATQSSFEPVPRPLTSESADLLPPAPFISQADHPTLGIPTWFLHPCNTQAVIQEVLCGEQDSLASYFNTWLMVVGSVVDLRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.63
3 0.71
4 0.79
5 0.8
6 0.79
7 0.77
8 0.73
9 0.73
10 0.72
11 0.65
12 0.6
13 0.53
14 0.45
15 0.41
16 0.36
17 0.31
18 0.27
19 0.26
20 0.23
21 0.21
22 0.2
23 0.18
24 0.21
25 0.18
26 0.14
27 0.13
28 0.15
29 0.15
30 0.15
31 0.16
32 0.14
33 0.14
34 0.14
35 0.14
36 0.1
37 0.11
38 0.11
39 0.1
40 0.09
41 0.09
42 0.1
43 0.11
44 0.1
45 0.09
46 0.1
47 0.09
48 0.09
49 0.09
50 0.11
51 0.1
52 0.1
53 0.12
54 0.12
55 0.12
56 0.13
57 0.12
58 0.1
59 0.1
60 0.12
61 0.11
62 0.11
63 0.11
64 0.11
65 0.1
66 0.1
67 0.1
68 0.09
69 0.16
70 0.16
71 0.16
72 0.15
73 0.17
74 0.19
75 0.2
76 0.19
77 0.11
78 0.12
79 0.14
80 0.14
81 0.12
82 0.1
83 0.08
84 0.08
85 0.09
86 0.08
87 0.06
88 0.06
89 0.06
90 0.06
91 0.06
92 0.07
93 0.07
94 0.08
95 0.07
96 0.07
97 0.08
98 0.07
99 0.09
100 0.09
101 0.09
102 0.1
103 0.11
104 0.15
105 0.15
106 0.18
107 0.17
108 0.19
109 0.21
110 0.2
111 0.2
112 0.17
113 0.17
114 0.14
115 0.13
116 0.1
117 0.09
118 0.08
119 0.07
120 0.06
121 0.07
122 0.1
123 0.13
124 0.15
125 0.18
126 0.17
127 0.17
128 0.18
129 0.18
130 0.14
131 0.11
132 0.1
133 0.08
134 0.12
135 0.13
136 0.14
137 0.16
138 0.18
139 0.2
140 0.24
141 0.24
142 0.21
143 0.21
144 0.24
145 0.23
146 0.21
147 0.2
148 0.15
149 0.14
150 0.14
151 0.13
152 0.09
153 0.08
154 0.08
155 0.09
156 0.1
157 0.1
158 0.1
159 0.1
160 0.11
161 0.11
162 0.11
163 0.09
164 0.09
165 0.08
166 0.09
167 0.08
168 0.07
169 0.08