Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A238FCF9

Protein Details
Accession A0A238FCF9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
100-121TQGATVHKMHKKKKQGHNKGYYHydrophilic
NLS Segment(s)
PositionSequence
110-113KKKK
Subcellular Location(s) extr 13, golg 6, mito 2, plas 2, E.R. 2
Family & Domain DBs
Amino Acid Sequences MVRYNLVIGAGLAMISAASIVSAMSKCQTDCGNRLSESTDCVGWDKTSCIYNDKSFTEGLIECLSATPECRKQIPGINGQLCVQCRKEKFDQAPMCSHLTQGATVHKMHKKKKQGHNKGYY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.03
4 0.02
5 0.02
6 0.02
7 0.02
8 0.04
9 0.05
10 0.06
11 0.07
12 0.09
13 0.09
14 0.12
15 0.16
16 0.18
17 0.21
18 0.24
19 0.27
20 0.26
21 0.27
22 0.27
23 0.24
24 0.22
25 0.2
26 0.17
27 0.13
28 0.14
29 0.14
30 0.12
31 0.12
32 0.11
33 0.11
34 0.13
35 0.13
36 0.15
37 0.17
38 0.19
39 0.22
40 0.21
41 0.21
42 0.19
43 0.18
44 0.17
45 0.14
46 0.13
47 0.1
48 0.09
49 0.07
50 0.08
51 0.08
52 0.06
53 0.07
54 0.09
55 0.13
56 0.15
57 0.16
58 0.17
59 0.19
60 0.26
61 0.29
62 0.33
63 0.37
64 0.36
65 0.36
66 0.36
67 0.36
68 0.31
69 0.3
70 0.25
71 0.24
72 0.24
73 0.3
74 0.34
75 0.4
76 0.44
77 0.51
78 0.55
79 0.53
80 0.56
81 0.53
82 0.51
83 0.42
84 0.38
85 0.3
86 0.24
87 0.21
88 0.19
89 0.21
90 0.2
91 0.21
92 0.29
93 0.33
94 0.41
95 0.49
96 0.56
97 0.61
98 0.69
99 0.78
100 0.82
101 0.87