Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A238F4G9

Protein Details
Accession A0A238F4G9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
137-166LPPFWVTCPYRSRRRRRRTQARFRDLRFGPHydrophilic
NLS Segment(s)
PositionSequence
149-155RRRRRRT
Subcellular Location(s) mito 14, cyto 10.5, cyto_nucl 6
Family & Domain DBs
Amino Acid Sequences MHTDLKRVSSCLRTSTVADLRSGVSPCPCDVGRIDVIKGQRAVRFPKDANLDTLAANGLTVGKTLCQVEKLFAPFKNGVIQCTLTGFFSDAEGVRLFDEEIAAFGKVLARRTQYIGKTKHISGVYDFVLALKDADNLPPFWVTCPYRSRRRRRRTQARFRDLRFGPHDQKTSNGAYSGCPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.41
3 0.41
4 0.35
5 0.33
6 0.3
7 0.28
8 0.29
9 0.28
10 0.21
11 0.19
12 0.19
13 0.19
14 0.22
15 0.2
16 0.19
17 0.19
18 0.23
19 0.24
20 0.25
21 0.25
22 0.24
23 0.26
24 0.28
25 0.29
26 0.27
27 0.25
28 0.28
29 0.34
30 0.35
31 0.4
32 0.36
33 0.4
34 0.44
35 0.41
36 0.39
37 0.36
38 0.32
39 0.26
40 0.25
41 0.19
42 0.12
43 0.11
44 0.08
45 0.06
46 0.04
47 0.05
48 0.04
49 0.04
50 0.06
51 0.07
52 0.07
53 0.09
54 0.1
55 0.11
56 0.13
57 0.16
58 0.18
59 0.18
60 0.22
61 0.21
62 0.21
63 0.27
64 0.24
65 0.22
66 0.2
67 0.2
68 0.16
69 0.16
70 0.16
71 0.09
72 0.09
73 0.09
74 0.07
75 0.06
76 0.07
77 0.06
78 0.07
79 0.07
80 0.07
81 0.06
82 0.06
83 0.06
84 0.05
85 0.05
86 0.04
87 0.04
88 0.05
89 0.05
90 0.04
91 0.04
92 0.07
93 0.08
94 0.1
95 0.12
96 0.14
97 0.15
98 0.18
99 0.24
100 0.27
101 0.34
102 0.36
103 0.4
104 0.42
105 0.41
106 0.44
107 0.39
108 0.35
109 0.28
110 0.28
111 0.22
112 0.19
113 0.18
114 0.13
115 0.12
116 0.11
117 0.09
118 0.06
119 0.07
120 0.07
121 0.1
122 0.11
123 0.11
124 0.12
125 0.13
126 0.13
127 0.13
128 0.2
129 0.19
130 0.23
131 0.31
132 0.37
133 0.47
134 0.57
135 0.67
136 0.71
137 0.8
138 0.86
139 0.89
140 0.94
141 0.94
142 0.96
143 0.96
144 0.96
145 0.94
146 0.86
147 0.85
148 0.75
149 0.72
150 0.67
151 0.64
152 0.61
153 0.6
154 0.61
155 0.52
156 0.54
157 0.5
158 0.48
159 0.41
160 0.35
161 0.28