Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G8ZLM9

Protein Details
Accession G8ZLM9    Localization Confidence High Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
60-80VIYRVRVRRGNRKRPVPKGATHydrophilic
175-204NKGHRFNNTKAGRRKTWKKNNTLSLWRYRKHydrophilic
NLS Segment(s)
PositionSequence
39-78ATRPSRPDKARRMGYKAKQGFVIYRVRVRRGNRKRPVPKG
162-194RGLTATGKKSRGINKGHRFNNTKAGRRKTWKKN
Subcellular Location(s) nucl 13.5, cyto_nucl 10.5, mito 7, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR024794  Rbsml_L15e_core_dom_sf  
IPR000439  Ribosomal_L15e  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG tdl:TDEL_0A01910  -  
Pfam View protein in Pfam  
PF00827  Ribosomal_L15e  
Amino Acid Sequences MGAYKYLEELQRKKQSDVLRFLQRVRVWEYRQKNVIHRATRPSRPDKARRMGYKAKQGFVIYRVRVRRGNRKRPVPKGATYGKPTNQGVNELKYQRALRATAEERVGRRASNLRVLNSYWVNQDSTYKYFEVILVDPSHKAIRRDARYNWICNPVHKHREARGLTATGKKSRGINKGHRFNNTKAGRRKTWKKNNTLSLWRYRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.6
3 0.6
4 0.62
5 0.6
6 0.6
7 0.6
8 0.6
9 0.61
10 0.55
11 0.5
12 0.49
13 0.49
14 0.45
15 0.52
16 0.56
17 0.56
18 0.61
19 0.61
20 0.61
21 0.63
22 0.66
23 0.62
24 0.61
25 0.63
26 0.64
27 0.67
28 0.68
29 0.66
30 0.67
31 0.7
32 0.75
33 0.74
34 0.76
35 0.78
36 0.76
37 0.76
38 0.77
39 0.74
40 0.76
41 0.7
42 0.62
43 0.55
44 0.5
45 0.44
46 0.39
47 0.39
48 0.31
49 0.33
50 0.35
51 0.36
52 0.41
53 0.45
54 0.51
55 0.55
56 0.64
57 0.66
58 0.74
59 0.79
60 0.82
61 0.85
62 0.8
63 0.73
64 0.69
65 0.66
66 0.61
67 0.57
68 0.53
69 0.46
70 0.45
71 0.42
72 0.38
73 0.32
74 0.32
75 0.29
76 0.27
77 0.29
78 0.25
79 0.25
80 0.25
81 0.25
82 0.21
83 0.21
84 0.19
85 0.14
86 0.19
87 0.2
88 0.19
89 0.21
90 0.21
91 0.2
92 0.23
93 0.23
94 0.17
95 0.17
96 0.2
97 0.19
98 0.25
99 0.27
100 0.25
101 0.26
102 0.27
103 0.28
104 0.25
105 0.24
106 0.17
107 0.16
108 0.15
109 0.14
110 0.16
111 0.16
112 0.17
113 0.18
114 0.16
115 0.16
116 0.16
117 0.16
118 0.15
119 0.13
120 0.13
121 0.12
122 0.13
123 0.13
124 0.14
125 0.17
126 0.17
127 0.18
128 0.23
129 0.31
130 0.37
131 0.43
132 0.44
133 0.51
134 0.54
135 0.57
136 0.54
137 0.53
138 0.48
139 0.47
140 0.52
141 0.51
142 0.53
143 0.54
144 0.56
145 0.52
146 0.61
147 0.58
148 0.54
149 0.49
150 0.45
151 0.43
152 0.45
153 0.45
154 0.4
155 0.4
156 0.38
157 0.4
158 0.45
159 0.49
160 0.51
161 0.57
162 0.62
163 0.71
164 0.73
165 0.76
166 0.74
167 0.7
168 0.72
169 0.69
170 0.68
171 0.68
172 0.71
173 0.71
174 0.76
175 0.83
176 0.84
177 0.86
178 0.87
179 0.87
180 0.89
181 0.9
182 0.88
183 0.87
184 0.83