Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A238FRK8

Protein Details
Accession A0A238FRK8    Localization Confidence High Confidence Score 17.3
NoLS Segment(s)
PositionSequenceProtein Nature
247-294GAMPPPQPPKRRGRPPKPKDPNAPPPIKPKTAPKRRKKRVESDVSLDSBasic
NLS Segment(s)
PositionSequence
173-210KMKFKSRKPLHADKAPPKVVKVKKPLGRPKGSKNKYKK
253-285QPPKRRGRPPKPKDPNAPPPIKPKTAPKRRKKR
Subcellular Location(s) nucl 19, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR019481  TFIIIC_triple_barrel  
Pfam View protein in Pfam  
PF10419  TFIIIC_sub6  
Amino Acid Sequences MPFTSAADCIDPPLVDRTWTRVERLEPRKQVDKAPNDGEDDSDDDEWEQDEVTYLTLDFGGKLAVETLNQERGHIQLLGLESSTPYARVGPQFYQGQHETLIGDQVLLQYHPETEPSPSHYVPLPSTSTSRIYFQPISIKPKEGHAVQPTTPSFLPHPFPTPPAPAPIMATGKMKFKSRKPLHADKAPPKVVKVKKPLGRPKGSKNKYKKGQWADEQEKDEDGEGGMPPLPTLEQEDQDGRSSIDLGAMPPPQPPKRRGRPPKPKDPNAPPPIKPKTAPKRRKKRVESDVSLDSDPGEGARIDVDEASEEEYGASRERGSTSVAIAGGSTRRALRRSAAAAAAAATAGGEKIESDDDEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.2
4 0.24
5 0.31
6 0.33
7 0.35
8 0.35
9 0.42
10 0.49
11 0.57
12 0.61
13 0.6
14 0.65
15 0.7
16 0.68
17 0.7
18 0.69
19 0.68
20 0.66
21 0.63
22 0.59
23 0.54
24 0.52
25 0.44
26 0.36
27 0.31
28 0.26
29 0.21
30 0.18
31 0.14
32 0.14
33 0.14
34 0.12
35 0.09
36 0.06
37 0.07
38 0.07
39 0.07
40 0.07
41 0.07
42 0.07
43 0.07
44 0.07
45 0.06
46 0.06
47 0.06
48 0.06
49 0.06
50 0.07
51 0.06
52 0.07
53 0.1
54 0.13
55 0.2
56 0.2
57 0.2
58 0.19
59 0.2
60 0.22
61 0.19
62 0.16
63 0.12
64 0.13
65 0.13
66 0.12
67 0.11
68 0.09
69 0.1
70 0.1
71 0.08
72 0.07
73 0.08
74 0.11
75 0.14
76 0.18
77 0.18
78 0.23
79 0.27
80 0.27
81 0.32
82 0.3
83 0.28
84 0.25
85 0.24
86 0.19
87 0.15
88 0.16
89 0.09
90 0.08
91 0.07
92 0.07
93 0.08
94 0.07
95 0.07
96 0.06
97 0.07
98 0.08
99 0.09
100 0.09
101 0.11
102 0.12
103 0.17
104 0.22
105 0.21
106 0.22
107 0.22
108 0.24
109 0.22
110 0.24
111 0.2
112 0.17
113 0.19
114 0.2
115 0.22
116 0.21
117 0.22
118 0.2
119 0.23
120 0.23
121 0.23
122 0.29
123 0.29
124 0.36
125 0.35
126 0.36
127 0.32
128 0.34
129 0.36
130 0.29
131 0.3
132 0.28
133 0.3
134 0.27
135 0.33
136 0.3
137 0.29
138 0.28
139 0.23
140 0.2
141 0.19
142 0.22
143 0.17
144 0.21
145 0.19
146 0.21
147 0.22
148 0.24
149 0.22
150 0.22
151 0.22
152 0.18
153 0.19
154 0.19
155 0.18
156 0.15
157 0.16
158 0.15
159 0.18
160 0.19
161 0.24
162 0.26
163 0.29
164 0.39
165 0.42
166 0.5
167 0.54
168 0.62
169 0.63
170 0.66
171 0.69
172 0.66
173 0.69
174 0.65
175 0.57
176 0.49
177 0.52
178 0.5
179 0.5
180 0.51
181 0.51
182 0.51
183 0.61
184 0.69
185 0.69
186 0.71
187 0.69
188 0.71
189 0.74
190 0.75
191 0.74
192 0.74
193 0.75
194 0.75
195 0.78
196 0.77
197 0.74
198 0.75
199 0.73
200 0.73
201 0.7
202 0.66
203 0.62
204 0.53
205 0.45
206 0.37
207 0.3
208 0.2
209 0.14
210 0.09
211 0.06
212 0.06
213 0.07
214 0.07
215 0.06
216 0.06
217 0.06
218 0.06
219 0.1
220 0.12
221 0.11
222 0.13
223 0.15
224 0.16
225 0.18
226 0.18
227 0.13
228 0.11
229 0.12
230 0.1
231 0.1
232 0.09
233 0.08
234 0.11
235 0.12
236 0.12
237 0.14
238 0.21
239 0.26
240 0.31
241 0.37
242 0.45
243 0.54
244 0.65
245 0.74
246 0.78
247 0.83
248 0.87
249 0.92
250 0.92
251 0.91
252 0.9
253 0.88
254 0.88
255 0.86
256 0.83
257 0.76
258 0.75
259 0.73
260 0.67
261 0.6
262 0.6
263 0.62
264 0.66
265 0.73
266 0.74
267 0.79
268 0.85
269 0.94
270 0.92
271 0.92
272 0.92
273 0.92
274 0.87
275 0.81
276 0.76
277 0.68
278 0.59
279 0.48
280 0.37
281 0.27
282 0.2
283 0.14
284 0.1
285 0.06
286 0.06
287 0.07
288 0.07
289 0.07
290 0.07
291 0.07
292 0.07
293 0.08
294 0.1
295 0.09
296 0.09
297 0.09
298 0.09
299 0.1
300 0.11
301 0.11
302 0.09
303 0.11
304 0.12
305 0.13
306 0.16
307 0.16
308 0.15
309 0.17
310 0.17
311 0.15
312 0.14
313 0.15
314 0.13
315 0.13
316 0.14
317 0.16
318 0.2
319 0.22
320 0.24
321 0.27
322 0.33
323 0.36
324 0.38
325 0.35
326 0.32
327 0.3
328 0.28
329 0.24
330 0.16
331 0.12
332 0.07
333 0.06
334 0.05
335 0.05
336 0.04
337 0.04
338 0.06
339 0.08