Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A238F285

Protein Details
Accession A0A238F285    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
6-38VRTNGVCTKPKPKPKPTPTRKPKPAPKGLCGNKHydrophilic
NLS Segment(s)
PositionSequence
14-32KPKPKPKPTPTRKPKPAPK
Subcellular Location(s) mito 20, nucl 6
Family & Domain DBs
Amino Acid Sequences MAITDVRTNGVCTKPKPKPKPTPTRKPKPAPKGLCGNKRCPPHPDHGFFHCIQGKKCLLSCSAGWQPKSNAVCVNIHNDVKYCGSTGRRCPGSYNGVGKAICTAGRCSLSCPRGSSIKKRGSSLYCTTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.6
3 0.68
4 0.74
5 0.79
6 0.84
7 0.9
8 0.91
9 0.92
10 0.92
11 0.94
12 0.93
13 0.93
14 0.92
15 0.91
16 0.91
17 0.86
18 0.81
19 0.81
20 0.8
21 0.79
22 0.73
23 0.7
24 0.66
25 0.66
26 0.63
27 0.58
28 0.53
29 0.53
30 0.56
31 0.55
32 0.52
33 0.49
34 0.51
35 0.46
36 0.47
37 0.42
38 0.36
39 0.3
40 0.31
41 0.29
42 0.26
43 0.27
44 0.23
45 0.19
46 0.19
47 0.18
48 0.19
49 0.24
50 0.26
51 0.25
52 0.26
53 0.25
54 0.29
55 0.3
56 0.25
57 0.2
58 0.19
59 0.2
60 0.2
61 0.24
62 0.21
63 0.21
64 0.2
65 0.19
66 0.19
67 0.17
68 0.17
69 0.13
70 0.12
71 0.17
72 0.22
73 0.27
74 0.33
75 0.35
76 0.35
77 0.38
78 0.4
79 0.41
80 0.42
81 0.4
82 0.34
83 0.35
84 0.35
85 0.32
86 0.28
87 0.22
88 0.18
89 0.15
90 0.15
91 0.16
92 0.19
93 0.19
94 0.22
95 0.3
96 0.33
97 0.34
98 0.35
99 0.35
100 0.41
101 0.47
102 0.53
103 0.54
104 0.6
105 0.6
106 0.61
107 0.65
108 0.6
109 0.62