Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A238F2D6

Protein Details
Accession A0A238F2D6    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
7-37HTAHNQTRKAHRNGIKKPKMNKYPSRKGLDPHydrophilic
NLS Segment(s)
PositionSequence
14-43RKAHRNGIKKPKMNKYPSRKGLDPKFRRNA
Subcellular Location(s) nucl 16.5, mito_nucl 11, cyto 5, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTAHNQTRKAHRNGIKKPKMNKYPSRKGLDPKFRRNARFAAMGTQKAVAAAKAAVASGHINVSFFLLALGFECKRNMAAYSILEQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.75
3 0.76
4 0.73
5 0.73
6 0.75
7 0.81
8 0.8
9 0.79
10 0.82
11 0.82
12 0.84
13 0.83
14 0.82
15 0.81
16 0.82
17 0.83
18 0.81
19 0.75
20 0.74
21 0.75
22 0.76
23 0.74
24 0.73
25 0.73
26 0.73
27 0.71
28 0.66
29 0.59
30 0.51
31 0.46
32 0.37
33 0.34
34 0.31
35 0.28
36 0.25
37 0.23
38 0.19
39 0.16
40 0.15
41 0.08
42 0.06
43 0.06
44 0.05
45 0.05
46 0.05
47 0.04
48 0.05
49 0.06
50 0.06
51 0.07
52 0.06
53 0.07
54 0.07
55 0.08
56 0.07
57 0.06
58 0.06
59 0.05
60 0.05
61 0.06
62 0.09
63 0.09
64 0.11
65 0.11
66 0.12
67 0.13
68 0.15
69 0.15
70 0.14
71 0.17
72 0.18