Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A238FK10

Protein Details
Accession A0A238FK10    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
4-24RVTLRTRKSYNTKSNGKRIVKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 12.833, mito 12, nucl 11.5, cyto_nucl 8.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR008195  Ribosomal_L34Ae  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01199  Ribosomal_L34e  
Amino Acid Sequences MVQRVTLRTRKSYNTKSNGKRIVKTPGRTFSFAGVTQRLDNRSWRGETWSGLGRMRWIEMEWIA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.76
3 0.77
4 0.81
5 0.82
6 0.77
7 0.71
8 0.65
9 0.66
10 0.63
11 0.62
12 0.58
13 0.57
14 0.55
15 0.54
16 0.5
17 0.42
18 0.37
19 0.31
20 0.27
21 0.2
22 0.17
23 0.17
24 0.19
25 0.19
26 0.18
27 0.21
28 0.23
29 0.25
30 0.27
31 0.26
32 0.29
33 0.29
34 0.29
35 0.29
36 0.3
37 0.28
38 0.28
39 0.27
40 0.25
41 0.24
42 0.24
43 0.21
44 0.17