Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A238FLL2

Protein Details
Accession A0A238FLL2   
Localization Confidence Medium
Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
233-259TEVQGGPLNKKKKKKRQRESEAGGNVTHydrophilic
NLS Segment(s)
PositionSequence
241-250NKKKKKKRQR
282-290RKKKKLKQG
Subcellular Location(s) nucl 19.5, cyto_nucl 13.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013942  Mediator_Med19_fun  
Gene Ontology GO:0016592  C:mediator complex  
GO:0003712  F:transcription coregulator activity  
GO:0006357  P:regulation of transcription by RNA polymerase II  
Amino Acid Sequences MEPPMMEAGPSRSMGPIASTSTSTSTSTWSGAAEASTSARGLSSLLISPSNVTPSPLTGSRDLISLFHLEPLYDTHLRPYLPQDTGEQTTTTTASNPNTPNPISSNGKGKQSQQQLVDQAPPAAAARIGISFGGIKLGALGPGATTESGNEGKQSTMGQARQQKQERTYSYLVADIPGRNAIRKDSYLKHLVLNPDSPAVDLRALDEDVLRDAFTLKPGTIPGFDALVWENDTEVQGGPLNKKKKKKRQRESEAGGNVTLTAAGMTPNLSGTTNSLSEDDHRKKKKLKQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.16
4 0.16
5 0.17
6 0.17
7 0.18
8 0.2
9 0.22
10 0.21
11 0.19
12 0.19
13 0.19
14 0.18
15 0.17
16 0.15
17 0.14
18 0.13
19 0.12
20 0.1
21 0.09
22 0.09
23 0.09
24 0.09
25 0.08
26 0.08
27 0.08
28 0.08
29 0.08
30 0.08
31 0.09
32 0.1
33 0.11
34 0.11
35 0.13
36 0.14
37 0.17
38 0.15
39 0.15
40 0.14
41 0.15
42 0.19
43 0.21
44 0.23
45 0.21
46 0.23
47 0.22
48 0.23
49 0.22
50 0.18
51 0.16
52 0.16
53 0.14
54 0.14
55 0.14
56 0.12
57 0.12
58 0.14
59 0.18
60 0.17
61 0.17
62 0.17
63 0.2
64 0.21
65 0.21
66 0.24
67 0.24
68 0.23
69 0.24
70 0.24
71 0.25
72 0.28
73 0.28
74 0.23
75 0.18
76 0.17
77 0.17
78 0.15
79 0.11
80 0.12
81 0.12
82 0.18
83 0.19
84 0.2
85 0.23
86 0.23
87 0.24
88 0.23
89 0.27
90 0.26
91 0.26
92 0.33
93 0.32
94 0.36
95 0.37
96 0.38
97 0.4
98 0.42
99 0.45
100 0.39
101 0.4
102 0.38
103 0.37
104 0.36
105 0.28
106 0.21
107 0.16
108 0.14
109 0.11
110 0.08
111 0.06
112 0.05
113 0.05
114 0.05
115 0.05
116 0.04
117 0.05
118 0.04
119 0.04
120 0.05
121 0.04
122 0.04
123 0.04
124 0.04
125 0.04
126 0.04
127 0.04
128 0.03
129 0.03
130 0.04
131 0.04
132 0.03
133 0.04
134 0.06
135 0.07
136 0.07
137 0.08
138 0.08
139 0.08
140 0.09
141 0.09
142 0.08
143 0.11
144 0.13
145 0.18
146 0.25
147 0.3
148 0.38
149 0.43
150 0.45
151 0.45
152 0.51
153 0.48
154 0.47
155 0.44
156 0.37
157 0.32
158 0.3
159 0.26
160 0.2
161 0.19
162 0.13
163 0.12
164 0.14
165 0.13
166 0.13
167 0.14
168 0.15
169 0.16
170 0.18
171 0.23
172 0.23
173 0.28
174 0.31
175 0.32
176 0.32
177 0.32
178 0.34
179 0.31
180 0.29
181 0.24
182 0.21
183 0.2
184 0.18
185 0.15
186 0.13
187 0.11
188 0.1
189 0.1
190 0.1
191 0.1
192 0.1
193 0.1
194 0.09
195 0.09
196 0.1
197 0.08
198 0.06
199 0.08
200 0.08
201 0.1
202 0.11
203 0.1
204 0.1
205 0.12
206 0.13
207 0.13
208 0.14
209 0.12
210 0.12
211 0.12
212 0.12
213 0.12
214 0.12
215 0.12
216 0.1
217 0.09
218 0.09
219 0.09
220 0.09
221 0.08
222 0.08
223 0.1
224 0.12
225 0.18
226 0.26
227 0.35
228 0.41
229 0.52
230 0.62
231 0.7
232 0.79
233 0.85
234 0.88
235 0.9
236 0.94
237 0.95
238 0.91
239 0.9
240 0.85
241 0.76
242 0.64
243 0.53
244 0.42
245 0.31
246 0.23
247 0.12
248 0.06
249 0.04
250 0.05
251 0.05
252 0.05
253 0.06
254 0.07
255 0.08
256 0.08
257 0.09
258 0.11
259 0.15
260 0.15
261 0.16
262 0.16
263 0.17
264 0.21
265 0.31
266 0.38
267 0.44
268 0.51
269 0.58
270 0.66