Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A238FB30

Protein Details
Accession A0A238FB30    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
76-95RTDRGYRKSMHKVPKWTKLTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MLFKPSLPLSVGLLWKNPWRMSQTRKMRARLRLKTVDHNIAVVQQASPSTWFLKEALVLPTEATMPAKNKYTTFSRTDRGYRKSMHKVPKWTKLTSRTNPLGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.27
3 0.31
4 0.3
5 0.29
6 0.31
7 0.37
8 0.43
9 0.51
10 0.57
11 0.62
12 0.68
13 0.73
14 0.74
15 0.77
16 0.8
17 0.77
18 0.75
19 0.73
20 0.69
21 0.7
22 0.69
23 0.64
24 0.53
25 0.46
26 0.37
27 0.3
28 0.27
29 0.18
30 0.12
31 0.07
32 0.07
33 0.06
34 0.07
35 0.07
36 0.07
37 0.07
38 0.08
39 0.08
40 0.08
41 0.09
42 0.1
43 0.1
44 0.09
45 0.09
46 0.08
47 0.08
48 0.08
49 0.08
50 0.07
51 0.08
52 0.09
53 0.12
54 0.15
55 0.16
56 0.17
57 0.2
58 0.25
59 0.28
60 0.31
61 0.34
62 0.35
63 0.38
64 0.46
65 0.5
66 0.5
67 0.51
68 0.52
69 0.56
70 0.62
71 0.66
72 0.68
73 0.67
74 0.73
75 0.77
76 0.81
77 0.78
78 0.74
79 0.74
80 0.73
81 0.76
82 0.73
83 0.74