Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A238FT67

Protein Details
Accession A0A238FT67   
Localization Confidence Medium
Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
106-141NKKIKFHSAHPRGNRRCKRHCRRRRRLAKRNIGHVGBasic
NLS Segment(s)
PositionSequence
104-135EPNKKIKFHSAHPRGNRRCKRHCRRRRRLAKR
168-181RGSSAKKPHAKHPA
Subcellular Location(s) nucl 16.5, cyto_nucl 11, mito 5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MRDEITKLPGIVFQKERATVEISRHTVTGASGNIWATRTGVAISKFGKCAATQYGQDEIGKRDQVVVPYVCQLDEPKQHTAAKVACGHSPAALSLAEKLNPKVEPNKKIKFHSAHPRGNRRCKRHCRRRRRLAKRNIGHVGTSYLTFSPQGGSPAKTRQSLAKVLPARGSSAKKPHAKHPARPTNTQPATHHARRPTNTPPAASPATPHLSEAEISDQLTESLMRGQMDTGCIIGVDHLSDMQTGGWTAYSKLGYLDTKGIRYDPFEVKNPNFWLTITKVTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.36
3 0.37
4 0.35
5 0.36
6 0.32
7 0.35
8 0.39
9 0.37
10 0.36
11 0.34
12 0.32
13 0.28
14 0.26
15 0.23
16 0.16
17 0.14
18 0.14
19 0.15
20 0.16
21 0.16
22 0.15
23 0.12
24 0.12
25 0.11
26 0.11
27 0.14
28 0.14
29 0.17
30 0.2
31 0.21
32 0.22
33 0.22
34 0.22
35 0.18
36 0.2
37 0.22
38 0.24
39 0.23
40 0.25
41 0.27
42 0.27
43 0.28
44 0.27
45 0.25
46 0.26
47 0.25
48 0.22
49 0.22
50 0.22
51 0.23
52 0.26
53 0.23
54 0.2
55 0.22
56 0.22
57 0.18
58 0.17
59 0.18
60 0.18
61 0.24
62 0.27
63 0.27
64 0.31
65 0.32
66 0.32
67 0.35
68 0.31
69 0.29
70 0.3
71 0.29
72 0.26
73 0.26
74 0.26
75 0.21
76 0.2
77 0.14
78 0.1
79 0.09
80 0.08
81 0.09
82 0.11
83 0.12
84 0.13
85 0.14
86 0.16
87 0.16
88 0.18
89 0.25
90 0.31
91 0.37
92 0.45
93 0.53
94 0.54
95 0.57
96 0.63
97 0.58
98 0.58
99 0.61
100 0.62
101 0.61
102 0.65
103 0.72
104 0.73
105 0.8
106 0.81
107 0.78
108 0.8
109 0.83
110 0.86
111 0.87
112 0.89
113 0.9
114 0.92
115 0.95
116 0.95
117 0.95
118 0.94
119 0.94
120 0.94
121 0.87
122 0.84
123 0.77
124 0.67
125 0.56
126 0.45
127 0.36
128 0.26
129 0.21
130 0.13
131 0.09
132 0.08
133 0.08
134 0.07
135 0.06
136 0.06
137 0.09
138 0.1
139 0.12
140 0.14
141 0.19
142 0.22
143 0.22
144 0.23
145 0.24
146 0.26
147 0.29
148 0.28
149 0.31
150 0.3
151 0.3
152 0.32
153 0.28
154 0.27
155 0.27
156 0.29
157 0.26
158 0.31
159 0.38
160 0.42
161 0.44
162 0.5
163 0.56
164 0.59
165 0.63
166 0.66
167 0.69
168 0.67
169 0.7
170 0.67
171 0.66
172 0.64
173 0.6
174 0.5
175 0.46
176 0.5
177 0.5
178 0.5
179 0.46
180 0.5
181 0.48
182 0.52
183 0.53
184 0.54
185 0.51
186 0.48
187 0.42
188 0.4
189 0.4
190 0.35
191 0.29
192 0.25
193 0.26
194 0.24
195 0.23
196 0.18
197 0.17
198 0.17
199 0.17
200 0.15
201 0.12
202 0.12
203 0.12
204 0.11
205 0.1
206 0.1
207 0.09
208 0.06
209 0.08
210 0.1
211 0.1
212 0.1
213 0.11
214 0.11
215 0.13
216 0.12
217 0.1
218 0.08
219 0.08
220 0.07
221 0.07
222 0.06
223 0.05
224 0.05
225 0.06
226 0.06
227 0.06
228 0.07
229 0.06
230 0.06
231 0.06
232 0.06
233 0.07
234 0.08
235 0.09
236 0.12
237 0.12
238 0.12
239 0.13
240 0.16
241 0.16
242 0.18
243 0.25
244 0.24
245 0.25
246 0.27
247 0.28
248 0.26
249 0.28
250 0.32
251 0.32
252 0.34
253 0.38
254 0.45
255 0.46
256 0.52
257 0.52
258 0.49
259 0.42
260 0.38
261 0.36
262 0.33