Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A238EYE7

Protein Details
Accession A0A238EYE7   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MTPTLTTMPKKKPKIKEHPSRIRMSLHydrophilic
NLS Segment(s)
PositionSequence
10-18KKKPKIKEH
Subcellular Location(s) nucl 17.5, cyto_nucl 11.833, mito_nucl 11.666, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036691  Endo/exonu/phosph_ase_sf  
Amino Acid Sequences MTPTLTTMPKKKPKIKEHPSRIRMSLWSKMMSTTKIPSVSFVAANVQSINEDRKRASLFSNLRSHNADVFLLSETGRPPPKRVAQWTQDDSLVVTIDPESPPNNLRASFSFPERVSDATFCVGDSKVRVVSIYAPYSDKPDKKRFLSHISTTLRRAMRDDLLPPAPLVGGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.89
3 0.9
4 0.91
5 0.92
6 0.9
7 0.86
8 0.77
9 0.69
10 0.66
11 0.6
12 0.56
13 0.48
14 0.43
15 0.37
16 0.38
17 0.38
18 0.33
19 0.31
20 0.27
21 0.27
22 0.28
23 0.28
24 0.26
25 0.26
26 0.25
27 0.22
28 0.19
29 0.18
30 0.16
31 0.16
32 0.14
33 0.11
34 0.1
35 0.11
36 0.16
37 0.15
38 0.17
39 0.17
40 0.2
41 0.22
42 0.22
43 0.23
44 0.27
45 0.29
46 0.34
47 0.42
48 0.39
49 0.4
50 0.42
51 0.4
52 0.32
53 0.29
54 0.22
55 0.14
56 0.14
57 0.12
58 0.09
59 0.08
60 0.08
61 0.07
62 0.11
63 0.16
64 0.16
65 0.18
66 0.23
67 0.28
68 0.32
69 0.38
70 0.41
71 0.41
72 0.48
73 0.48
74 0.43
75 0.38
76 0.34
77 0.28
78 0.21
79 0.15
80 0.08
81 0.06
82 0.05
83 0.06
84 0.06
85 0.07
86 0.07
87 0.08
88 0.09
89 0.11
90 0.13
91 0.12
92 0.14
93 0.15
94 0.21
95 0.21
96 0.23
97 0.26
98 0.24
99 0.26
100 0.25
101 0.25
102 0.2
103 0.19
104 0.18
105 0.14
106 0.14
107 0.11
108 0.12
109 0.11
110 0.1
111 0.11
112 0.12
113 0.12
114 0.12
115 0.12
116 0.11
117 0.15
118 0.19
119 0.19
120 0.18
121 0.19
122 0.2
123 0.26
124 0.33
125 0.35
126 0.38
127 0.46
128 0.52
129 0.55
130 0.63
131 0.63
132 0.65
133 0.66
134 0.63
135 0.63
136 0.63
137 0.62
138 0.56
139 0.57
140 0.51
141 0.44
142 0.43
143 0.38
144 0.36
145 0.36
146 0.35
147 0.35
148 0.34
149 0.34
150 0.31
151 0.26