Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A238F689

Protein Details
Accession A0A238F689   
Localization Confidence High
Confidence Score 18.7
NoLS Segment(s)
PositionSequenceProtein Nature
24-51RSGSSSTSLEKRKKKKRKVEPESILSSSHydrophilic
297-319AANFLTKKKKDRSTGPKYPKYTGHydrophilic
NLS Segment(s)
PositionSequence
34-41KRKKKKRK
225-259LKLAKAEKAKQKREELEKEIKKMEWGKGLVQRGEK
Subcellular Location(s) nucl 18, mito 3, cyto 3, cyto_mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR018609  Bud13  
Gene Ontology GO:0005681  C:spliceosomal complex  
Pfam View protein in Pfam  
PF09736  Bud13  
Amino Acid Sequences MSDLQAYLAAKYMTGAKADAILERSGSSSTSLEKRKKKKRKVEPESILSSSRGEASTSYGHAGTGGGLIIDDDDGMEWARKWNEEDDEDGRPVVEQQKGQFKAKASTASSWSTIREAAFDEPAYVRTPSPEPVDEEPVVVGSVVQDAAPPPSASRGGLQSAASLRAEQARRDLDLAAKKKQADAELEARRRELRERGETLDEDIQGDDDHTATVYRDASGRKIDLKLAKAEKAKQKREELEKEIKKMEWGKGLVQRGEKEQRQKEREKMANLPMARYADDEDMNVEMKDRDRWNDPAANFLTKKKKDRSTGPKYPKYTGPMPAPNRFGILPGYRWDGVDRSNGFEATYMQKINARKMRTAEAHAYSTQDM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.13
4 0.17
5 0.17
6 0.19
7 0.17
8 0.16
9 0.16
10 0.16
11 0.17
12 0.14
13 0.14
14 0.14
15 0.12
16 0.17
17 0.24
18 0.33
19 0.41
20 0.51
21 0.61
22 0.7
23 0.8
24 0.86
25 0.89
26 0.91
27 0.93
28 0.94
29 0.94
30 0.92
31 0.89
32 0.85
33 0.77
34 0.67
35 0.57
36 0.47
37 0.37
38 0.29
39 0.22
40 0.16
41 0.13
42 0.15
43 0.16
44 0.16
45 0.17
46 0.15
47 0.15
48 0.14
49 0.14
50 0.1
51 0.08
52 0.07
53 0.05
54 0.04
55 0.04
56 0.04
57 0.04
58 0.04
59 0.03
60 0.03
61 0.04
62 0.05
63 0.06
64 0.06
65 0.1
66 0.12
67 0.13
68 0.15
69 0.19
70 0.23
71 0.23
72 0.28
73 0.27
74 0.29
75 0.29
76 0.27
77 0.22
78 0.18
79 0.19
80 0.19
81 0.19
82 0.18
83 0.21
84 0.31
85 0.35
86 0.38
87 0.39
88 0.36
89 0.37
90 0.38
91 0.39
92 0.33
93 0.32
94 0.33
95 0.31
96 0.31
97 0.28
98 0.26
99 0.21
100 0.2
101 0.17
102 0.14
103 0.14
104 0.13
105 0.14
106 0.13
107 0.13
108 0.12
109 0.13
110 0.14
111 0.13
112 0.11
113 0.12
114 0.14
115 0.15
116 0.18
117 0.18
118 0.21
119 0.23
120 0.28
121 0.25
122 0.24
123 0.21
124 0.18
125 0.16
126 0.12
127 0.09
128 0.04
129 0.04
130 0.04
131 0.04
132 0.04
133 0.04
134 0.05
135 0.06
136 0.06
137 0.06
138 0.08
139 0.09
140 0.09
141 0.1
142 0.11
143 0.11
144 0.13
145 0.12
146 0.12
147 0.12
148 0.13
149 0.12
150 0.1
151 0.09
152 0.14
153 0.15
154 0.14
155 0.17
156 0.17
157 0.17
158 0.18
159 0.18
160 0.17
161 0.23
162 0.26
163 0.26
164 0.28
165 0.27
166 0.28
167 0.29
168 0.26
169 0.22
170 0.22
171 0.27
172 0.31
173 0.34
174 0.33
175 0.32
176 0.31
177 0.3
178 0.29
179 0.27
180 0.26
181 0.29
182 0.32
183 0.34
184 0.35
185 0.34
186 0.33
187 0.3
188 0.23
189 0.18
190 0.15
191 0.12
192 0.09
193 0.09
194 0.07
195 0.04
196 0.04
197 0.04
198 0.04
199 0.04
200 0.06
201 0.06
202 0.06
203 0.09
204 0.1
205 0.12
206 0.14
207 0.15
208 0.16
209 0.17
210 0.21
211 0.23
212 0.24
213 0.29
214 0.3
215 0.33
216 0.34
217 0.4
218 0.45
219 0.51
220 0.57
221 0.56
222 0.61
223 0.63
224 0.69
225 0.69
226 0.67
227 0.68
228 0.65
229 0.62
230 0.57
231 0.5
232 0.45
233 0.43
234 0.38
235 0.34
236 0.3
237 0.32
238 0.35
239 0.39
240 0.38
241 0.37
242 0.36
243 0.37
244 0.43
245 0.43
246 0.47
247 0.51
248 0.58
249 0.62
250 0.67
251 0.68
252 0.7
253 0.71
254 0.66
255 0.64
256 0.61
257 0.6
258 0.53
259 0.47
260 0.4
261 0.35
262 0.31
263 0.26
264 0.21
265 0.17
266 0.17
267 0.16
268 0.14
269 0.13
270 0.14
271 0.12
272 0.11
273 0.1
274 0.11
275 0.17
276 0.19
277 0.22
278 0.25
279 0.29
280 0.34
281 0.39
282 0.38
283 0.39
284 0.39
285 0.42
286 0.39
287 0.43
288 0.48
289 0.48
290 0.57
291 0.58
292 0.64
293 0.65
294 0.75
295 0.78
296 0.78
297 0.82
298 0.84
299 0.85
300 0.81
301 0.78
302 0.73
303 0.69
304 0.63
305 0.6
306 0.57
307 0.58
308 0.6
309 0.62
310 0.6
311 0.54
312 0.51
313 0.44
314 0.37
315 0.32
316 0.29
317 0.25
318 0.24
319 0.29
320 0.27
321 0.28
322 0.29
323 0.25
324 0.24
325 0.3
326 0.28
327 0.28
328 0.29
329 0.29
330 0.27
331 0.25
332 0.26
333 0.22
334 0.25
335 0.21
336 0.2
337 0.25
338 0.28
339 0.37
340 0.41
341 0.41
342 0.42
343 0.46
344 0.54
345 0.54
346 0.58
347 0.56
348 0.53
349 0.53
350 0.49