Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A238FKY8

Protein Details
Accession A0A238FKY8    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
16-37VIAKAPKPSNRKGKQSNRQAFVHydrophilic
55-85MELIRNSKDKKARKLTKKRLGTLRRAKRKVDBasic
NLS Segment(s)
PositionSequence
60-83NSKDKKARKLTKKRLGTLRRAKRK
Subcellular Location(s) cyto 11, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR038097  L36e_sf  
IPR000509  Ribosomal_L36e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01158  Ribosomal_L36e  
PROSITE View protein in PROSITE  
PS01190  RIBOSOMAL_L36E  
Amino Acid Sequences MIDLPWGINKGHPTTVIAKAPKPSNRKGKQSNRQAFVKSIVREVAGFAPYERRVMELIRNSKDKKARKLTKKRLGTLRRAKRKVDELTGVIAEQRRHAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.32
3 0.35
4 0.34
5 0.33
6 0.37
7 0.44
8 0.48
9 0.5
10 0.53
11 0.57
12 0.62
13 0.69
14 0.74
15 0.78
16 0.81
17 0.85
18 0.85
19 0.8
20 0.76
21 0.68
22 0.59
23 0.54
24 0.5
25 0.4
26 0.32
27 0.27
28 0.23
29 0.21
30 0.2
31 0.16
32 0.11
33 0.1
34 0.08
35 0.11
36 0.11
37 0.12
38 0.11
39 0.1
40 0.1
41 0.11
42 0.16
43 0.2
44 0.26
45 0.29
46 0.35
47 0.35
48 0.41
49 0.48
50 0.5
51 0.53
52 0.58
53 0.65
54 0.7
55 0.8
56 0.85
57 0.88
58 0.89
59 0.87
60 0.86
61 0.84
62 0.84
63 0.83
64 0.83
65 0.84
66 0.8
67 0.77
68 0.74
69 0.75
70 0.71
71 0.67
72 0.61
73 0.52
74 0.51
75 0.47
76 0.4
77 0.34
78 0.31
79 0.24