Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A238FIH6

Protein Details
Accession A0A238FIH6    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
4-30HDSSATKPQKKSKNSSHKKATTKPGRSHydrophilic
NLS Segment(s)
PositionSequence
12-23QKKSKNSSHKKA
Subcellular Location(s) nucl 23.5, mito_nucl 14.333, cyto_nucl 12.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR036910  HMG_box_dom_sf  
Amino Acid Sequences MPRHDSSATKPQKKSKNSSHKKATTKPGRSSNFNAFLNMKLAELKKSDPTRSHAERLKQINDLWKIETGKKKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.78
3 0.79
4 0.81
5 0.84
6 0.86
7 0.85
8 0.85
9 0.83
10 0.83
11 0.82
12 0.8
13 0.77
14 0.76
15 0.72
16 0.69
17 0.66
18 0.63
19 0.58
20 0.51
21 0.45
22 0.36
23 0.32
24 0.29
25 0.23
26 0.16
27 0.12
28 0.13
29 0.13
30 0.13
31 0.15
32 0.21
33 0.24
34 0.28
35 0.29
36 0.33
37 0.4
38 0.44
39 0.49
40 0.48
41 0.5
42 0.54
43 0.58
44 0.56
45 0.51
46 0.48
47 0.5
48 0.49
49 0.45
50 0.39
51 0.38
52 0.38
53 0.43