Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8ZV95

Protein Details
Accession G8ZV95    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
103-128NLRKRNREAKEKKLKKLRHRDPLTMFBasic
NLS Segment(s)
PositionSequence
105-122RKRNREAKEKKLKKLRHR
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR040357  Vma22/CCDC115  
Gene Ontology GO:0070072  P:vacuolar proton-transporting V-type ATPase complex assembly  
KEGG tdl:TDEL_0E02960  -  
Amino Acid Sequences MEEDQEHLELLKLLARYDLLLEQLQKSMREGFQNLGRANYHNKDTLRGRYGSDYWDEAYEGQLSVERGTDGRISFVKVKLDEDEKEEPIVDEKVDEKLHDEANLRKRNREAKEKKLKKLRHRDPLTMFGGAFSIPQSLRQCQMNFKGLFPLIEELINCKTAMTEVMTKLETSNN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.11
4 0.12
5 0.13
6 0.12
7 0.14
8 0.15
9 0.16
10 0.19
11 0.21
12 0.19
13 0.2
14 0.22
15 0.22
16 0.24
17 0.25
18 0.26
19 0.29
20 0.35
21 0.34
22 0.32
23 0.31
24 0.29
25 0.34
26 0.34
27 0.31
28 0.3
29 0.3
30 0.34
31 0.38
32 0.42
33 0.4
34 0.38
35 0.37
36 0.35
37 0.36
38 0.32
39 0.29
40 0.23
41 0.2
42 0.19
43 0.17
44 0.13
45 0.13
46 0.11
47 0.09
48 0.07
49 0.08
50 0.08
51 0.08
52 0.08
53 0.07
54 0.06
55 0.08
56 0.1
57 0.08
58 0.1
59 0.1
60 0.12
61 0.15
62 0.16
63 0.18
64 0.16
65 0.18
66 0.18
67 0.2
68 0.18
69 0.21
70 0.22
71 0.19
72 0.19
73 0.18
74 0.16
75 0.14
76 0.14
77 0.09
78 0.06
79 0.07
80 0.09
81 0.09
82 0.09
83 0.1
84 0.12
85 0.12
86 0.14
87 0.15
88 0.19
89 0.28
90 0.37
91 0.35
92 0.36
93 0.41
94 0.48
95 0.52
96 0.57
97 0.55
98 0.58
99 0.69
100 0.75
101 0.79
102 0.8
103 0.83
104 0.82
105 0.86
106 0.85
107 0.84
108 0.82
109 0.81
110 0.76
111 0.74
112 0.66
113 0.56
114 0.46
115 0.35
116 0.29
117 0.21
118 0.16
119 0.09
120 0.09
121 0.07
122 0.13
123 0.16
124 0.18
125 0.21
126 0.27
127 0.28
128 0.32
129 0.38
130 0.41
131 0.39
132 0.38
133 0.4
134 0.36
135 0.34
136 0.29
137 0.26
138 0.18
139 0.18
140 0.17
141 0.16
142 0.17
143 0.18
144 0.16
145 0.13
146 0.12
147 0.12
148 0.14
149 0.14
150 0.17
151 0.18
152 0.22
153 0.23
154 0.23