Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G8ZPZ3

Protein Details
Accession G8ZPZ3    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
21-42VTLWTRARYWLRQKLHRTSDWRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 7.5, mito 6, plas 5, cyto_nucl 5, golg 4, cyto 1.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR017850  Alkaline_phosphatase_core_sf  
IPR002591  Phosphodiest/P_Trfase  
Gene Ontology GO:0016020  C:membrane  
GO:0019637  P:organophosphate metabolic process  
GO:0006796  P:phosphate-containing compound metabolic process  
KEGG tdl:TDEL_0B05580  -  
Pfam View protein in Pfam  
PF01663  Phosphodiest  
CDD cd16018  Enpp  
Amino Acid Sequences MSELDNNSVLSQDFLDDPHNVTLWTRARYWLRQKLHRTSDWRPQGIPLYDLDSQGRSLDDSLLKRPRSFRWLWQLLATVLFAAITLTVVIGVISTTGKTPKGVNFDPHNQYWNGSHAFYPLTVVVSLDGFHPSLISERFTPFLHGLYTLNYTDKITSSPYMFPSFPSQTFPNHWTLVTGKYPRDHGIVSNVFWDQELQEEFHPGVLDPRVWANASTPIWEVLQTAYNHQGDFPFKVAAHMWPGSDVDYSSVDSVPIERTPYYKDDFDAAESLDAKLKRVLEFVDMGSLEERPQLVLSYVPQVDAFGHHHGYPIADKKNKNFREFTEVLSGVDRYVEGIVYGLEARNVSQFANVIIVSDHGMSNIENPAHIVVWEDLLDKQLRKRVEHAYGEGPMLAVTPRDHSDTNELYREITKSLKELGDLGSKFTVYLNGNFPERFQLNDVGNKRIAPIWIIPEPGYAVMNQAFAKKQKDKIVGNHGYDNHTPEMRSLFIAMGPFFERGYVEPFENVELFDLLCDLNGVAMRDRFGDTQDTLFYKKFMQDEFEDDFAYLETLYGNGTSYNQIWAGETEEEEDEDEDEDDEKIEGEESESNSDSESDSDSEDEDVSEEPTPTSSAEAATATATASSWLDSLTQEAEELVQEVVDEIQDLINNNVT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.14
3 0.14
4 0.17
5 0.18
6 0.18
7 0.17
8 0.17
9 0.24
10 0.27
11 0.29
12 0.27
13 0.33
14 0.39
15 0.49
16 0.59
17 0.6
18 0.64
19 0.7
20 0.78
21 0.81
22 0.83
23 0.82
24 0.8
25 0.77
26 0.78
27 0.79
28 0.73
29 0.63
30 0.59
31 0.59
32 0.53
33 0.47
34 0.37
35 0.33
36 0.31
37 0.31
38 0.29
39 0.22
40 0.2
41 0.19
42 0.18
43 0.14
44 0.13
45 0.16
46 0.2
47 0.22
48 0.3
49 0.38
50 0.4
51 0.43
52 0.47
53 0.49
54 0.51
55 0.53
56 0.54
57 0.56
58 0.59
59 0.57
60 0.55
61 0.51
62 0.44
63 0.41
64 0.31
65 0.2
66 0.14
67 0.12
68 0.09
69 0.06
70 0.05
71 0.04
72 0.04
73 0.03
74 0.03
75 0.03
76 0.03
77 0.03
78 0.03
79 0.04
80 0.04
81 0.05
82 0.06
83 0.09
84 0.1
85 0.12
86 0.15
87 0.2
88 0.27
89 0.31
90 0.37
91 0.41
92 0.49
93 0.54
94 0.53
95 0.52
96 0.44
97 0.43
98 0.37
99 0.35
100 0.29
101 0.24
102 0.22
103 0.2
104 0.2
105 0.18
106 0.18
107 0.13
108 0.12
109 0.11
110 0.11
111 0.09
112 0.09
113 0.09
114 0.08
115 0.09
116 0.08
117 0.07
118 0.07
119 0.07
120 0.1
121 0.11
122 0.13
123 0.13
124 0.15
125 0.17
126 0.17
127 0.21
128 0.18
129 0.18
130 0.16
131 0.16
132 0.15
133 0.15
134 0.18
135 0.15
136 0.15
137 0.15
138 0.15
139 0.15
140 0.15
141 0.14
142 0.14
143 0.15
144 0.17
145 0.19
146 0.21
147 0.24
148 0.23
149 0.24
150 0.28
151 0.3
152 0.28
153 0.3
154 0.28
155 0.28
156 0.33
157 0.34
158 0.32
159 0.29
160 0.28
161 0.25
162 0.26
163 0.26
164 0.28
165 0.28
166 0.26
167 0.27
168 0.3
169 0.3
170 0.31
171 0.27
172 0.22
173 0.27
174 0.26
175 0.24
176 0.24
177 0.22
178 0.2
179 0.19
180 0.18
181 0.1
182 0.11
183 0.11
184 0.1
185 0.11
186 0.12
187 0.12
188 0.12
189 0.13
190 0.09
191 0.11
192 0.1
193 0.1
194 0.1
195 0.11
196 0.11
197 0.11
198 0.12
199 0.11
200 0.16
201 0.16
202 0.17
203 0.16
204 0.16
205 0.16
206 0.16
207 0.15
208 0.09
209 0.14
210 0.13
211 0.14
212 0.19
213 0.19
214 0.19
215 0.19
216 0.2
217 0.17
218 0.18
219 0.18
220 0.14
221 0.13
222 0.14
223 0.15
224 0.14
225 0.16
226 0.15
227 0.13
228 0.13
229 0.13
230 0.13
231 0.12
232 0.11
233 0.08
234 0.08
235 0.09
236 0.09
237 0.09
238 0.08
239 0.07
240 0.08
241 0.08
242 0.08
243 0.1
244 0.09
245 0.1
246 0.13
247 0.17
248 0.19
249 0.18
250 0.18
251 0.18
252 0.18
253 0.18
254 0.16
255 0.13
256 0.11
257 0.11
258 0.11
259 0.13
260 0.12
261 0.12
262 0.13
263 0.14
264 0.14
265 0.14
266 0.15
267 0.12
268 0.14
269 0.13
270 0.12
271 0.11
272 0.11
273 0.1
274 0.1
275 0.08
276 0.07
277 0.07
278 0.06
279 0.06
280 0.06
281 0.05
282 0.06
283 0.06
284 0.1
285 0.1
286 0.1
287 0.09
288 0.09
289 0.09
290 0.1
291 0.12
292 0.1
293 0.11
294 0.11
295 0.11
296 0.11
297 0.12
298 0.13
299 0.16
300 0.2
301 0.25
302 0.26
303 0.32
304 0.43
305 0.47
306 0.49
307 0.46
308 0.42
309 0.45
310 0.45
311 0.4
312 0.36
313 0.31
314 0.27
315 0.25
316 0.23
317 0.14
318 0.13
319 0.1
320 0.05
321 0.05
322 0.04
323 0.03
324 0.03
325 0.03
326 0.04
327 0.04
328 0.04
329 0.04
330 0.04
331 0.04
332 0.05
333 0.06
334 0.06
335 0.06
336 0.06
337 0.06
338 0.07
339 0.07
340 0.06
341 0.05
342 0.06
343 0.06
344 0.06
345 0.06
346 0.05
347 0.06
348 0.05
349 0.06
350 0.08
351 0.07
352 0.06
353 0.07
354 0.07
355 0.07
356 0.07
357 0.07
358 0.05
359 0.06
360 0.06
361 0.07
362 0.07
363 0.09
364 0.1
365 0.1
366 0.12
367 0.16
368 0.18
369 0.19
370 0.23
371 0.28
372 0.34
373 0.35
374 0.36
375 0.34
376 0.33
377 0.32
378 0.27
379 0.2
380 0.13
381 0.11
382 0.08
383 0.06
384 0.05
385 0.07
386 0.09
387 0.11
388 0.12
389 0.13
390 0.19
391 0.21
392 0.24
393 0.24
394 0.23
395 0.21
396 0.22
397 0.22
398 0.17
399 0.16
400 0.14
401 0.13
402 0.16
403 0.16
404 0.14
405 0.15
406 0.16
407 0.2
408 0.2
409 0.2
410 0.17
411 0.17
412 0.16
413 0.15
414 0.18
415 0.12
416 0.15
417 0.17
418 0.18
419 0.21
420 0.2
421 0.21
422 0.21
423 0.2
424 0.19
425 0.17
426 0.2
427 0.2
428 0.28
429 0.3
430 0.28
431 0.29
432 0.27
433 0.26
434 0.23
435 0.21
436 0.16
437 0.15
438 0.17
439 0.17
440 0.19
441 0.18
442 0.16
443 0.17
444 0.15
445 0.14
446 0.09
447 0.09
448 0.08
449 0.1
450 0.11
451 0.12
452 0.14
453 0.18
454 0.25
455 0.28
456 0.34
457 0.4
458 0.47
459 0.5
460 0.55
461 0.62
462 0.62
463 0.59
464 0.59
465 0.53
466 0.5
467 0.46
468 0.42
469 0.34
470 0.27
471 0.25
472 0.21
473 0.21
474 0.17
475 0.16
476 0.14
477 0.11
478 0.11
479 0.13
480 0.11
481 0.11
482 0.12
483 0.12
484 0.11
485 0.11
486 0.1
487 0.1
488 0.14
489 0.14
490 0.14
491 0.14
492 0.15
493 0.16
494 0.16
495 0.15
496 0.11
497 0.1
498 0.09
499 0.08
500 0.08
501 0.06
502 0.05
503 0.05
504 0.04
505 0.05
506 0.06
507 0.08
508 0.09
509 0.1
510 0.11
511 0.12
512 0.15
513 0.15
514 0.15
515 0.18
516 0.17
517 0.18
518 0.21
519 0.21
520 0.22
521 0.22
522 0.21
523 0.19
524 0.22
525 0.23
526 0.21
527 0.24
528 0.23
529 0.28
530 0.31
531 0.3
532 0.27
533 0.24
534 0.23
535 0.18
536 0.17
537 0.11
538 0.06
539 0.05
540 0.05
541 0.05
542 0.05
543 0.05
544 0.05
545 0.07
546 0.09
547 0.1
548 0.12
549 0.12
550 0.12
551 0.13
552 0.13
553 0.15
554 0.14
555 0.13
556 0.14
557 0.14
558 0.14
559 0.13
560 0.13
561 0.1
562 0.1
563 0.1
564 0.09
565 0.09
566 0.09
567 0.09
568 0.08
569 0.08
570 0.07
571 0.08
572 0.07
573 0.08
574 0.12
575 0.13
576 0.17
577 0.17
578 0.17
579 0.17
580 0.18
581 0.16
582 0.14
583 0.15
584 0.12
585 0.12
586 0.13
587 0.13
588 0.14
589 0.13
590 0.12
591 0.1
592 0.1
593 0.11
594 0.12
595 0.11
596 0.11
597 0.11
598 0.12
599 0.11
600 0.13
601 0.11
602 0.11
603 0.11
604 0.11
605 0.11
606 0.11
607 0.1
608 0.09
609 0.08
610 0.07
611 0.08
612 0.08
613 0.08
614 0.07
615 0.08
616 0.09
617 0.09
618 0.11
619 0.11
620 0.11
621 0.1
622 0.1
623 0.1
624 0.1
625 0.1
626 0.08
627 0.07
628 0.06
629 0.07
630 0.07
631 0.06
632 0.06
633 0.06
634 0.07
635 0.09
636 0.1