Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X7QZS0

Protein Details
Accession A0A1X7QZS0    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
16-43LWKIPWRLSAPQKRRQRQRLRDVDNVIKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, nucl 3.5, cyto_nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFKSTNTLLGGLLWKIPWRLSAPQKRRQRQRLRDVDNVIKQLTLGLHVMRSQAKGLTFEESLVAKKMYKPRSEAMRLINKPSFFPKENQMSSKDKYTVFSKKDNGYRKGVHKVPKWTKLSLRRNPKFF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.12
4 0.13
5 0.14
6 0.14
7 0.15
8 0.17
9 0.25
10 0.34
11 0.45
12 0.51
13 0.6
14 0.7
15 0.77
16 0.84
17 0.87
18 0.87
19 0.87
20 0.89
21 0.91
22 0.87
23 0.85
24 0.81
25 0.78
26 0.71
27 0.63
28 0.52
29 0.41
30 0.33
31 0.26
32 0.2
33 0.13
34 0.1
35 0.08
36 0.08
37 0.09
38 0.11
39 0.11
40 0.11
41 0.1
42 0.11
43 0.11
44 0.13
45 0.13
46 0.14
47 0.12
48 0.12
49 0.12
50 0.11
51 0.11
52 0.1
53 0.1
54 0.08
55 0.12
56 0.19
57 0.24
58 0.26
59 0.29
60 0.33
61 0.4
62 0.44
63 0.44
64 0.44
65 0.48
66 0.47
67 0.49
68 0.47
69 0.4
70 0.37
71 0.39
72 0.37
73 0.29
74 0.3
75 0.32
76 0.38
77 0.41
78 0.42
79 0.42
80 0.42
81 0.43
82 0.45
83 0.41
84 0.33
85 0.33
86 0.37
87 0.41
88 0.39
89 0.43
90 0.44
91 0.48
92 0.56
93 0.62
94 0.6
95 0.59
96 0.61
97 0.61
98 0.64
99 0.63
100 0.64
101 0.62
102 0.69
103 0.71
104 0.74
105 0.72
106 0.69
107 0.73
108 0.74
109 0.78
110 0.77
111 0.79