Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X7QZK0

Protein Details
Accession A0A1X7QZK0    Localization Confidence Low Confidence Score 5.7
NoLS Segment(s)
PositionSequenceProtein Nature
102-121QHTRNNARTARKLNKLDRKGHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 19, mito 4, nucl 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR027437  30s_Rbsml_prot_S13_C  
IPR001892  Ribosomal_S13  
IPR010979  Ribosomal_S13-like_H2TH  
IPR018269  Ribosomal_S13_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003723  F:RNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00416  Ribosomal_S13  
PROSITE View protein in PROSITE  
PS00646  RIBOSOMAL_S13_1  
PS50159  RIBOSOMAL_S13_2  
Amino Acid Sequences MVVHILGKAFKGKEVLRIALASKFYGIGEKTATTVCSKLGFYPWMRMHQLSEAQIMNIASELSTITIEDEARAVVKRNIALKKSIGTYEGLRHVLHLPVRGQHTRNNARTARKLNKLDRKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.34
3 0.3
4 0.31
5 0.3
6 0.28
7 0.28
8 0.2
9 0.16
10 0.15
11 0.13
12 0.15
13 0.14
14 0.12
15 0.12
16 0.12
17 0.13
18 0.13
19 0.14
20 0.12
21 0.12
22 0.12
23 0.12
24 0.12
25 0.12
26 0.14
27 0.17
28 0.16
29 0.24
30 0.26
31 0.28
32 0.3
33 0.29
34 0.28
35 0.27
36 0.29
37 0.21
38 0.22
39 0.17
40 0.15
41 0.16
42 0.14
43 0.11
44 0.08
45 0.07
46 0.04
47 0.04
48 0.04
49 0.03
50 0.03
51 0.03
52 0.04
53 0.04
54 0.04
55 0.04
56 0.05
57 0.04
58 0.05
59 0.06
60 0.07
61 0.08
62 0.1
63 0.13
64 0.19
65 0.24
66 0.25
67 0.27
68 0.27
69 0.28
70 0.28
71 0.26
72 0.21
73 0.18
74 0.19
75 0.21
76 0.23
77 0.23
78 0.2
79 0.21
80 0.22
81 0.23
82 0.23
83 0.23
84 0.2
85 0.23
86 0.29
87 0.32
88 0.33
89 0.35
90 0.44
91 0.51
92 0.54
93 0.58
94 0.58
95 0.61
96 0.68
97 0.72
98 0.71
99 0.71
100 0.75
101 0.77