Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X7R695

Protein Details
Accession A0A1X7R695    Localization Confidence Low Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
122-143EGEERKQLRQRRKDIIKVIQNEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10, cyto_nucl 8.5, E.R. 7, cyto 5, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036533  BAG_dom_sf  
IPR003103  BAG_domain  
Gene Ontology GO:0016020  C:membrane  
GO:0051087  F:protein-folding chaperone binding  
Pfam View protein in Pfam  
PF02179  BAG  
PROSITE View protein in PROSITE  
PS51035  BAG  
Amino Acid Sequences MDTEKITKYIEDNVSGDAMGAISLFIAVATMFLWNYVSRKNEANFGKKKAPTMDPKPIALNPTEQLENIFLRYENEFKDRIAKIMELYSPDDDKDVYERNYCNEMLLKLLIELDGVDLLALEGEERKQLRQRRKDIIKVIQNELVKLDSLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.24
3 0.22
4 0.13
5 0.1
6 0.07
7 0.05
8 0.04
9 0.03
10 0.03
11 0.03
12 0.02
13 0.02
14 0.02
15 0.03
16 0.03
17 0.04
18 0.04
19 0.04
20 0.05
21 0.06
22 0.08
23 0.12
24 0.14
25 0.16
26 0.21
27 0.22
28 0.29
29 0.34
30 0.42
31 0.44
32 0.47
33 0.53
34 0.49
35 0.52
36 0.49
37 0.5
38 0.49
39 0.51
40 0.55
41 0.5
42 0.5
43 0.49
44 0.45
45 0.4
46 0.31
47 0.26
48 0.17
49 0.17
50 0.16
51 0.13
52 0.13
53 0.13
54 0.13
55 0.11
56 0.1
57 0.08
58 0.09
59 0.1
60 0.11
61 0.11
62 0.13
63 0.13
64 0.13
65 0.19
66 0.18
67 0.18
68 0.17
69 0.16
70 0.15
71 0.16
72 0.16
73 0.12
74 0.14
75 0.14
76 0.13
77 0.13
78 0.12
79 0.11
80 0.11
81 0.11
82 0.13
83 0.14
84 0.17
85 0.17
86 0.2
87 0.23
88 0.22
89 0.21
90 0.19
91 0.17
92 0.15
93 0.15
94 0.12
95 0.1
96 0.1
97 0.08
98 0.06
99 0.06
100 0.05
101 0.04
102 0.04
103 0.03
104 0.03
105 0.03
106 0.03
107 0.03
108 0.03
109 0.04
110 0.04
111 0.09
112 0.1
113 0.14
114 0.22
115 0.3
116 0.41
117 0.51
118 0.59
119 0.65
120 0.74
121 0.8
122 0.82
123 0.84
124 0.82
125 0.77
126 0.73
127 0.68
128 0.6
129 0.51
130 0.44
131 0.35