Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X7R3Z6

Protein Details
Accession A0A1X7R3Z6    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
7-26HTAHNQTKKAHRNGIKKPKTBasic
NLS Segment(s)
PositionSequence
14-62KKAHRNGIKKPKTYKYPSLKGVDPKFKRNHKHALHGTAKALAAKRAAKN
Subcellular Location(s) nucl 17, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTAHNQTKKAHRNGIKKPKTYKYPSLKGVDPKFKRNHKHALHGTAKALAAKRAAKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.75
3 0.75
4 0.72
5 0.72
6 0.75
7 0.81
8 0.8
9 0.78
10 0.79
11 0.77
12 0.77
13 0.75
14 0.74
15 0.72
16 0.69
17 0.68
18 0.64
19 0.6
20 0.59
21 0.58
22 0.59
23 0.53
24 0.54
25 0.57
26 0.61
27 0.65
28 0.64
29 0.68
30 0.62
31 0.7
32 0.68
33 0.69
34 0.67
35 0.62
36 0.57
37 0.49
38 0.45
39 0.39
40 0.33
41 0.26
42 0.26