Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X7R894

Protein Details
Accession A0A1X7R894    Localization Confidence High Confidence Score 18.4
NoLS Segment(s)
PositionSequenceProtein Nature
48-95DPAVRRLKEIRNKERLKNKSNEKPKDKIIKRRSTTRRKKINDTEQDIGHydrophilic
311-330QNWLRKHDEAKAKARNRSKRBasic
NLS Segment(s)
PositionSequence
52-86RRLKEIRNKERLKNKSNEKPKDKIIKRRSTTRRKK
315-330RKHDEAKAKARNRSKR
Subcellular Location(s) nucl 26, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013256  Chromatin_SPT2  
Pfam View protein in Pfam  
PF08243  SPT2  
Amino Acid Sequences MSFLSKLSKLKRNSPSYHADNSSNINKKNEIEEEPSSLLPTNYIRDEDPAVRRLKEIRNKERLKNKSNEKPKDKIIKRRSTTRRKKINDTEQDIGTVYKRRLGSNSNKSSQTNIMKRREPIKKMSFEELMKQADSQDIIKTNAIRNNTKTTHLNKPGFKKRNPIRGKNNDIMKQNQVPPPPSSSSSSKNINEPKVIHLNTRIGTSIARPHARFQAKLNKHKQYAAAEDEYDEDLDDFIEEDEEEEEERIRDNRGYDRDEIWAMFNRPGQRNHYRPQEDEWDSDDMETNEIDIMAEEEEATRAARLEDKREQNWLRKHDEAKAKARNRSKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.71
3 0.69
4 0.71
5 0.65
6 0.58
7 0.51
8 0.52
9 0.55
10 0.53
11 0.51
12 0.47
13 0.45
14 0.44
15 0.48
16 0.46
17 0.41
18 0.4
19 0.39
20 0.4
21 0.39
22 0.37
23 0.32
24 0.28
25 0.23
26 0.19
27 0.19
28 0.18
29 0.17
30 0.19
31 0.18
32 0.2
33 0.24
34 0.28
35 0.31
36 0.33
37 0.35
38 0.34
39 0.35
40 0.4
41 0.45
42 0.48
43 0.55
44 0.59
45 0.66
46 0.72
47 0.79
48 0.82
49 0.82
50 0.81
51 0.8
52 0.8
53 0.8
54 0.83
55 0.85
56 0.82
57 0.79
58 0.79
59 0.81
60 0.79
61 0.79
62 0.79
63 0.79
64 0.78
65 0.83
66 0.84
67 0.84
68 0.87
69 0.87
70 0.87
71 0.83
72 0.88
73 0.88
74 0.88
75 0.86
76 0.82
77 0.75
78 0.65
79 0.59
80 0.49
81 0.39
82 0.3
83 0.25
84 0.18
85 0.19
86 0.2
87 0.21
88 0.23
89 0.3
90 0.38
91 0.44
92 0.52
93 0.51
94 0.53
95 0.52
96 0.52
97 0.52
98 0.51
99 0.48
100 0.49
101 0.52
102 0.53
103 0.56
104 0.62
105 0.63
106 0.59
107 0.6
108 0.59
109 0.59
110 0.59
111 0.59
112 0.54
113 0.47
114 0.46
115 0.41
116 0.34
117 0.27
118 0.24
119 0.2
120 0.16
121 0.16
122 0.13
123 0.1
124 0.11
125 0.12
126 0.13
127 0.14
128 0.17
129 0.19
130 0.22
131 0.23
132 0.24
133 0.3
134 0.3
135 0.32
136 0.34
137 0.36
138 0.42
139 0.47
140 0.5
141 0.49
142 0.56
143 0.63
144 0.65
145 0.63
146 0.64
147 0.62
148 0.67
149 0.7
150 0.7
151 0.7
152 0.72
153 0.77
154 0.72
155 0.71
156 0.66
157 0.61
158 0.54
159 0.48
160 0.43
161 0.41
162 0.38
163 0.35
164 0.32
165 0.3
166 0.31
167 0.29
168 0.27
169 0.27
170 0.27
171 0.29
172 0.3
173 0.35
174 0.32
175 0.37
176 0.4
177 0.39
178 0.38
179 0.35
180 0.35
181 0.37
182 0.36
183 0.31
184 0.28
185 0.3
186 0.27
187 0.27
188 0.23
189 0.16
190 0.15
191 0.15
192 0.18
193 0.2
194 0.24
195 0.24
196 0.26
197 0.34
198 0.37
199 0.37
200 0.37
201 0.42
202 0.46
203 0.56
204 0.62
205 0.61
206 0.6
207 0.62
208 0.6
209 0.54
210 0.5
211 0.45
212 0.38
213 0.3
214 0.28
215 0.27
216 0.23
217 0.19
218 0.14
219 0.09
220 0.07
221 0.06
222 0.06
223 0.05
224 0.04
225 0.05
226 0.04
227 0.05
228 0.05
229 0.06
230 0.06
231 0.06
232 0.07
233 0.07
234 0.09
235 0.09
236 0.11
237 0.12
238 0.15
239 0.22
240 0.26
241 0.3
242 0.32
243 0.32
244 0.33
245 0.33
246 0.31
247 0.26
248 0.26
249 0.24
250 0.24
251 0.26
252 0.3
253 0.34
254 0.38
255 0.43
256 0.47
257 0.52
258 0.57
259 0.64
260 0.62
261 0.59
262 0.61
263 0.63
264 0.56
265 0.52
266 0.47
267 0.4
268 0.35
269 0.33
270 0.3
271 0.21
272 0.18
273 0.16
274 0.13
275 0.1
276 0.09
277 0.09
278 0.06
279 0.06
280 0.06
281 0.06
282 0.06
283 0.06
284 0.06
285 0.07
286 0.07
287 0.07
288 0.07
289 0.08
290 0.15
291 0.18
292 0.25
293 0.35
294 0.42
295 0.44
296 0.54
297 0.6
298 0.62
299 0.68
300 0.68
301 0.66
302 0.65
303 0.67
304 0.66
305 0.7
306 0.69
307 0.7
308 0.73
309 0.73
310 0.75