Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8ZNX2

Protein Details
Accession G8ZNX2    Localization Confidence Low Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
113-133SDPCAPLSRKKQNRKHPLLPLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19.5, mito_nucl 13.333, nucl 6, cyto_nucl 3.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR043141  Ribosomal_L10-like_sf  
IPR001790  Ribosomal_L10P  
KEGG tdl:TDEL_0B01870  -  
Pfam View protein in Pfam  
PF00466  Ribosomal_L10  
CDD cd05797  Ribosomal_L10  
Amino Acid Sequences MSLSGLLGLRLPLIQVLGKPYVSRSWWRSYAVSSHTSLEGRITVKPLESRKTFLVDSYKHMMETSPVVLFVHYNNLMKNEDHHYRSLVKQQGGRLTMLRNSLFSVYLKNSKASDPCAPLSRKKQNRKHPLLPLLKGPTAAITFAETNPVSVAKILKMLERAQDKLFVVGAKVETEVYDVTQLNQFKTLPSKPELQAQLLGLLNVLGGAGLVRTLEAGSQTLYLTLSSHQDNQSSDNKKEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.14
4 0.16
5 0.16
6 0.17
7 0.19
8 0.22
9 0.25
10 0.31
11 0.32
12 0.38
13 0.41
14 0.44
15 0.43
16 0.42
17 0.44
18 0.41
19 0.39
20 0.33
21 0.31
22 0.3
23 0.29
24 0.26
25 0.21
26 0.19
27 0.17
28 0.17
29 0.18
30 0.16
31 0.18
32 0.24
33 0.27
34 0.32
35 0.33
36 0.35
37 0.35
38 0.38
39 0.36
40 0.33
41 0.36
42 0.31
43 0.34
44 0.36
45 0.34
46 0.3
47 0.3
48 0.26
49 0.2
50 0.2
51 0.16
52 0.11
53 0.11
54 0.11
55 0.11
56 0.11
57 0.1
58 0.13
59 0.13
60 0.14
61 0.14
62 0.17
63 0.18
64 0.18
65 0.2
66 0.21
67 0.24
68 0.25
69 0.26
70 0.26
71 0.27
72 0.29
73 0.34
74 0.34
75 0.32
76 0.32
77 0.34
78 0.37
79 0.36
80 0.34
81 0.28
82 0.24
83 0.23
84 0.24
85 0.21
86 0.16
87 0.16
88 0.15
89 0.15
90 0.13
91 0.13
92 0.12
93 0.18
94 0.18
95 0.19
96 0.19
97 0.2
98 0.21
99 0.22
100 0.24
101 0.21
102 0.22
103 0.27
104 0.28
105 0.31
106 0.38
107 0.45
108 0.5
109 0.58
110 0.66
111 0.7
112 0.79
113 0.83
114 0.82
115 0.79
116 0.8
117 0.75
118 0.67
119 0.62
120 0.55
121 0.46
122 0.39
123 0.31
124 0.22
125 0.17
126 0.15
127 0.1
128 0.08
129 0.09
130 0.08
131 0.12
132 0.1
133 0.1
134 0.1
135 0.1
136 0.09
137 0.09
138 0.1
139 0.06
140 0.1
141 0.1
142 0.11
143 0.14
144 0.15
145 0.2
146 0.22
147 0.24
148 0.22
149 0.25
150 0.24
151 0.22
152 0.22
153 0.16
154 0.13
155 0.12
156 0.12
157 0.09
158 0.09
159 0.08
160 0.07
161 0.08
162 0.08
163 0.07
164 0.1
165 0.09
166 0.1
167 0.15
168 0.16
169 0.16
170 0.18
171 0.17
172 0.16
173 0.22
174 0.24
175 0.24
176 0.26
177 0.32
178 0.31
179 0.39
180 0.4
181 0.36
182 0.35
183 0.31
184 0.32
185 0.26
186 0.24
187 0.16
188 0.13
189 0.1
190 0.08
191 0.07
192 0.03
193 0.02
194 0.02
195 0.02
196 0.02
197 0.03
198 0.03
199 0.03
200 0.04
201 0.04
202 0.05
203 0.06
204 0.07
205 0.08
206 0.08
207 0.09
208 0.09
209 0.09
210 0.09
211 0.1
212 0.13
213 0.15
214 0.2
215 0.22
216 0.25
217 0.26
218 0.3
219 0.38
220 0.41