Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X7R0P9

Protein Details
Accession A0A1X7R0P9   
Localization Confidence Medium
Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
88-116PDTQLGQRRKQLRKENRSKIKQNNFISQLHydrophilic
NLS Segment(s)
PositionSequence
95-104RRKQLRKENR
Subcellular Location(s) nucl 17, cyto_nucl 10.5, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MIRLNTLKFFSTSRYLLQKNVSSTKNVDATKVISSCLVGTKLNLDIKKGKQGPVALDDNEYPDWLWTVLKDDSKKAKPDKEPKESPSPDTQLGQRRKQLRKENRSKIKQNNFISQL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.35
3 0.37
4 0.42
5 0.42
6 0.42
7 0.47
8 0.44
9 0.38
10 0.39
11 0.4
12 0.41
13 0.37
14 0.32
15 0.27
16 0.27
17 0.28
18 0.26
19 0.21
20 0.14
21 0.14
22 0.14
23 0.14
24 0.13
25 0.09
26 0.09
27 0.11
28 0.14
29 0.18
30 0.18
31 0.19
32 0.23
33 0.24
34 0.33
35 0.34
36 0.31
37 0.3
38 0.32
39 0.31
40 0.3
41 0.31
42 0.22
43 0.21
44 0.19
45 0.19
46 0.17
47 0.15
48 0.1
49 0.07
50 0.07
51 0.07
52 0.07
53 0.04
54 0.08
55 0.1
56 0.14
57 0.15
58 0.2
59 0.27
60 0.32
61 0.39
62 0.41
63 0.47
64 0.53
65 0.63
66 0.67
67 0.69
68 0.71
69 0.7
70 0.75
71 0.69
72 0.64
73 0.61
74 0.56
75 0.48
76 0.44
77 0.44
78 0.44
79 0.49
80 0.51
81 0.51
82 0.56
83 0.62
84 0.7
85 0.75
86 0.76
87 0.8
88 0.85
89 0.88
90 0.9
91 0.92
92 0.92
93 0.92
94 0.92
95 0.9
96 0.86