Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3NZA4

Protein Details
Accession A0A1Y3NZA4   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-21QCEEKHWKKKEIKKCPFEILSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, cyto_nucl 10.5, cyto 6, mito 5
Family & Domain DBs
PROSITE View protein in PROSITE  
PS50890  PUA  
Amino Acid Sequences QCEEKHWKKKEIKKCPFEILSNQVLCFPLEVIDNDTFENFPRYEKEVIVDIHCGKSVLRGSDIYAPGLLAMSQNSNVQKAFKNYKLFKITKIIYNICIFKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.82
3 0.77
4 0.71
5 0.66
6 0.6
7 0.57
8 0.49
9 0.43
10 0.35
11 0.31
12 0.27
13 0.21
14 0.15
15 0.09
16 0.09
17 0.09
18 0.12
19 0.12
20 0.12
21 0.12
22 0.12
23 0.12
24 0.11
25 0.14
26 0.1
27 0.1
28 0.12
29 0.15
30 0.16
31 0.16
32 0.17
33 0.17
34 0.18
35 0.17
36 0.18
37 0.15
38 0.14
39 0.14
40 0.13
41 0.09
42 0.12
43 0.13
44 0.12
45 0.12
46 0.12
47 0.14
48 0.19
49 0.2
50 0.17
51 0.15
52 0.13
53 0.12
54 0.12
55 0.1
56 0.05
57 0.05
58 0.05
59 0.07
60 0.1
61 0.11
62 0.12
63 0.13
64 0.15
65 0.19
66 0.25
67 0.32
68 0.35
69 0.44
70 0.46
71 0.55
72 0.62
73 0.6
74 0.56
75 0.58
76 0.55
77 0.52
78 0.56
79 0.5
80 0.45
81 0.49