Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y3N557

Protein Details
Accession A0A1Y3N557    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
171-201APRSPRSGKSPKFTKKTKSKTPKSPKSPKSTHydrophilic
NLS Segment(s)
PositionSequence
173-200RSPRSGKSPKFTKKTKSKTPKSPKSPKS
Subcellular Location(s) nucl 15, cyto 6, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011012  Longin-like_dom_sf  
IPR007222  Sig_recog_particle_rcpt_asu_N  
Gene Ontology GO:0005785  C:signal recognition particle receptor complex  
GO:0005525  F:GTP binding  
GO:0003924  F:GTPase activity  
GO:0005047  F:signal recognition particle binding  
GO:0006886  P:intracellular protein transport  
Pfam View protein in Pfam  
PF04086  SRP-alpha_N  
CDD cd14826  SR_alpha_SRX  
Amino Acid Sequences MIDLFTILTKGGVVLWTKSFTSVTSNPIDALIKDVLINERGDSTSYIKNEYELKWKFSNETNLIFVVAYQKIIQLTYADELLNATQKAFLKKYSEEIQNPLDCEQYEFDDEFTNLLTKIEMKDNESRKNKVQRSFKDTEAYKTTLEGSQKKLNKKDESSEEEEEMPSPTFAPRSPRSGKSPKFTKKTKSKTPKSPKSPKST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.14
3 0.16
4 0.17
5 0.18
6 0.18
7 0.16
8 0.22
9 0.22
10 0.24
11 0.25
12 0.25
13 0.24
14 0.25
15 0.26
16 0.18
17 0.2
18 0.15
19 0.12
20 0.12
21 0.13
22 0.13
23 0.14
24 0.15
25 0.11
26 0.12
27 0.12
28 0.13
29 0.14
30 0.16
31 0.19
32 0.2
33 0.22
34 0.21
35 0.22
36 0.25
37 0.25
38 0.31
39 0.29
40 0.33
41 0.33
42 0.34
43 0.34
44 0.35
45 0.42
46 0.35
47 0.35
48 0.31
49 0.29
50 0.28
51 0.25
52 0.21
53 0.16
54 0.12
55 0.1
56 0.09
57 0.1
58 0.09
59 0.1
60 0.1
61 0.07
62 0.07
63 0.08
64 0.08
65 0.07
66 0.07
67 0.07
68 0.07
69 0.09
70 0.08
71 0.07
72 0.09
73 0.11
74 0.14
75 0.15
76 0.16
77 0.17
78 0.18
79 0.22
80 0.25
81 0.29
82 0.27
83 0.3
84 0.32
85 0.29
86 0.29
87 0.26
88 0.21
89 0.15
90 0.15
91 0.12
92 0.1
93 0.1
94 0.1
95 0.1
96 0.1
97 0.1
98 0.09
99 0.08
100 0.08
101 0.06
102 0.06
103 0.06
104 0.06
105 0.07
106 0.12
107 0.12
108 0.15
109 0.23
110 0.28
111 0.37
112 0.41
113 0.44
114 0.47
115 0.56
116 0.59
117 0.6
118 0.65
119 0.63
120 0.67
121 0.67
122 0.63
123 0.6
124 0.55
125 0.52
126 0.47
127 0.42
128 0.33
129 0.3
130 0.29
131 0.24
132 0.28
133 0.27
134 0.27
135 0.34
136 0.39
137 0.46
138 0.52
139 0.57
140 0.59
141 0.6
142 0.62
143 0.62
144 0.64
145 0.63
146 0.58
147 0.52
148 0.45
149 0.42
150 0.34
151 0.28
152 0.21
153 0.14
154 0.12
155 0.11
156 0.12
157 0.13
158 0.21
159 0.22
160 0.3
161 0.36
162 0.41
163 0.49
164 0.58
165 0.63
166 0.65
167 0.72
168 0.74
169 0.77
170 0.8
171 0.82
172 0.82
173 0.85
174 0.86
175 0.87
176 0.87
177 0.9
178 0.93
179 0.93
180 0.93
181 0.94