Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y3MPC7

Protein Details
Accession A0A1Y3MPC7    Localization Confidence Low Confidence Score 5.7
NoLS Segment(s)
PositionSequenceProtein Nature
21-41SSPIEKKKCFVKVPKNSVNKIHydrophilic
NLS Segment(s)
Subcellular Location(s) E.R. 13, extr 5, nucl 2, plas 2, golg 2, cyto 1, pero 1, vacu 1, mito_nucl 1, cyto_pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR024079  MetalloPept_cat_dom_sf  
IPR000718  Peptidase_M13  
Gene Ontology GO:0004222  F:metalloendopeptidase activity  
GO:0006508  P:proteolysis  
PROSITE View protein in PROSITE  
PS51885  NEPRILYSIN  
Amino Acid Sequences MNFKTISAILTILTLDLLVLSSPIEKKKCFVKVPKNSVNKIDISQTIPQTNPQTIPENVNIMDITEVTDSSSDDEPELIIDVEKVTEIETELETEFVTEIETVIDDDDENVCNTKECIDVSNNIINNMDESVNPCEDFYQFTCGNYIKNNPVNGINILLKAFDKPESYISM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.04
3 0.04
4 0.04
5 0.03
6 0.04
7 0.04
8 0.07
9 0.1
10 0.16
11 0.2
12 0.21
13 0.24
14 0.32
15 0.4
16 0.45
17 0.53
18 0.58
19 0.65
20 0.75
21 0.81
22 0.82
23 0.77
24 0.73
25 0.66
26 0.57
27 0.48
28 0.41
29 0.34
30 0.29
31 0.3
32 0.28
33 0.27
34 0.25
35 0.28
36 0.27
37 0.27
38 0.24
39 0.23
40 0.25
41 0.24
42 0.27
43 0.24
44 0.23
45 0.21
46 0.2
47 0.17
48 0.13
49 0.12
50 0.08
51 0.08
52 0.06
53 0.06
54 0.05
55 0.06
56 0.05
57 0.08
58 0.08
59 0.07
60 0.07
61 0.07
62 0.07
63 0.07
64 0.07
65 0.05
66 0.04
67 0.04
68 0.04
69 0.04
70 0.04
71 0.04
72 0.03
73 0.03
74 0.04
75 0.05
76 0.05
77 0.06
78 0.06
79 0.06
80 0.06
81 0.06
82 0.05
83 0.04
84 0.05
85 0.04
86 0.04
87 0.04
88 0.04
89 0.04
90 0.04
91 0.04
92 0.03
93 0.04
94 0.05
95 0.06
96 0.06
97 0.07
98 0.07
99 0.07
100 0.07
101 0.08
102 0.09
103 0.08
104 0.11
105 0.12
106 0.14
107 0.18
108 0.23
109 0.22
110 0.21
111 0.21
112 0.19
113 0.17
114 0.17
115 0.13
116 0.08
117 0.11
118 0.14
119 0.15
120 0.15
121 0.14
122 0.13
123 0.13
124 0.17
125 0.15
126 0.18
127 0.18
128 0.18
129 0.21
130 0.21
131 0.23
132 0.23
133 0.26
134 0.28
135 0.33
136 0.34
137 0.33
138 0.35
139 0.36
140 0.33
141 0.32
142 0.25
143 0.21
144 0.2
145 0.19
146 0.17
147 0.16
148 0.16
149 0.15
150 0.16
151 0.17